KEGG   Rhodopseudomonas palustris BisB18: RPC_0764Help
Entry
RPC_0764          CDS       T00336                                 

Definition
alpha/beta hydrolase fold protein
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
rpc  Rhodopseudomonas palustris BisB18
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:rpc00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    RPC_0764
Enzymes [BR:rpc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     RPC_0764
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
846089..847036
Genome map
AA seq 315 aa AA seqDB search
MTLVSIPANPVPEDAVSGFIKTPDGAELRFARWPPPSGRKGTVCVFTGRGEQIEKYFETV
RDLRDRGFAVAIIDWRGQGHSSRRLRDPRKGYVRDFSDFETDVEAFVQQVVLPDCPPPHF
ALAHSMGGAVLLRIAHSGKRWFDRIVLSAPMIDLPGRATTLPVRLLLRSLRLAGQGGNYV
PGGNDQLAGSGPFADNQLTSDPVRYARNAAILAEDPTLGIGSPTVAWADTAFRAMHGFKA
VNFPARIRQPILMMAASHDTVVSTPAIEEMAYHLRGGAHLVIAGAKHEILQEQDRYRGQF
WAAFDAFVPGTPMFE
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgacgctcgtctcgattcccgccaatccggtccccgaagacgccgtcagcggcttcatc
aagactcccgacggcgccgaattgcggttcgcccgctggccgccgccgtccggccgcaag
ggcacggtgtgcgtgttcaccggccgcggcgaacagatcgaaaaatacttcgagacggtg
cgcgacctgcgcgaccgcggcttcgcggtggcgatcatcgactggcgcggccagggccat
tcgtcgcggcgcttgcgcgacccgcgcaagggctatgtccgcgatttctccgacttcgaa
accgacgtcgaggccttcgtgcagcaggtggtgctgccggattgcccgccgccgcatttc
gcgctggcgcattcgatgggcggcgcggtgctgttgcggattgcgcattccggcaagcgc
tggttcgaccgcatcgtactgtcggcgccgatgatcgacctgccgggtcgggccaccacg
ctgccggtgcggctgctgctgcggtcgctgcggctcgccgggcagggcggcaattacgtc
cccggcggcaacgatcagctcgccggcagcggcccgttcgccgacaatcagctgaccagc
gacccggtgcgctacgcccgcaacgccgcgatcctcgccgaagacccgacgctcggcatc
ggctcgccgaccgtggcctgggccgacaccgcgttccgcgcgatgcacggcttcaaggcg
gtgaattttccggcgcggatccgccagccgatcctgatgatggccgccagccacgacacc
gtggtgtcgacgccggcgatcgaggaaatggcctatcacctgcgcggcggcgcgcatctg
gtgatcgccggcgccaagcacgaaatcctgcaggagcaggaccgctatcgcggccagttc
tgggcggcgttcgacgccttcgtgccgggcacgccgatgttcgaatga

  All links  
No link information was found.   
DBGET integrated database retrieval system