KEGG   Rhodopseudomonas palustris BisB18: RPC_0765Help
Entry
RPC_0765          CDS       T00336                                 

Definition
(GenBank) UDP-glucose pyrophosphorylase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
rpc  Rhodopseudomonas palustris BisB18
Pathway
rpc00040  Pentose and glucuronate interconversions
rpc00052  Galactose metabolism
rpc00500  Starch and sucrose metabolism
rpc00520  Amino sugar and nucleotide sugar metabolism
rpc01100  Metabolic pathways
rpc01130  Biosynthesis of antibiotics
Module
rpc_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:rpc00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    RPC_0765
   00052 Galactose metabolism
    RPC_0765
   00500 Starch and sucrose metabolism
    RPC_0765
   00520 Amino sugar and nucleotide sugar metabolism
    RPC_0765
Enzymes [BR:rpc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     RPC_0765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 CTP_transf_3
Motif
Other DBs
NCBI-ProteinID: ABD86336
UniProt: Q21BA0
Position
847184..848059
Genome map
AA seq 291 aa AA seqDB search
MKIRKAVFPVAGLGTRVLPATKAMPKEMLTIVDRPLIQYVVDEAKEAGIEHFIFVTGRNK
GMIEDHFDRQFELDMTLKGRNKTAEMEMLARDQPEAGAMSFTRQQAPHGLGHAVWCARDI
VGNEPFAVVLPDELVLNSPGCLAQMIAAAEKLGDKANVIAVEQVPTHLTHNYGICGVGAR
NGNMFEIDGMVEKPPQGTAPSTLSISGRYILQPEIFKILETQERGAGGEIQLTDAMIGLS
KTQKFYGVEFEGERHDCGSKAGFLRANIAFAMKRPDLRDELRATMKHYLAE
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattcgtaaagccgtctttccggtcgccggcctcggcacccgcgttctgcccgcc
accaaggcgatgccgaaggagatgctgaccatcgtcgaccggccgctgatccaatacgtc
gtcgacgaggccaaggaggccgggatcgagcatttcatcttcgtcaccggccgcaacaag
ggcatgatcgaggaccatttcgaccgccagttcgaattggacatgacgctgaagggccgc
aacaagaccgccgagatggagatgctggcgcgcgaccagccggaagccggcgcgatgagc
ttcaccaggcagcaggcgccgcacggcctcggtcacgcagtatggtgcgcccgcgacatc
gtcggcaacgaaccgttcgcggtggtgttgccggacgaactggtgctgaactcgccgggc
tgcctcgcccagatgatcgccgccgccgagaagctcggcgataaggccaacgtcatcgcg
gtcgagcaggtgccgacgcatctcacccataattacggcatctgcggtgtcggagcgcgc
aacggcaacatgttcgaaatcgacggcatggtggagaagccgccgcagggcaccgcgcct
tcgacgctgtcgatctccgggcgctacatcctgcagccggagatcttcaagatcctggag
acccaggaacgcggcgccggcggcgagatccagctcaccgacgcgatgatcgggctgtcg
aagacgcagaagttctacggcgtggaattcgagggcgagcgccacgactgcggctcgaaa
gccggcttcctgcgcgccaacatcgccttcgcgatgaagcgcccggacctgcgcgacgaa
ctgcgcgccaccatgaagcactatctggcggagtga

DBGET integrated database retrieval system