KEGG   Rhodopseudomonas palustris BisB18: RPC_1036Help
Entry
RPC_1036          CDS       T00336                                 

Definition
enoyl-CoA hydratase/isomerase
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
rpc  Rhodopseudomonas palustris BisB18
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:rpc00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    RPC_1036
  Carbohydrate metabolism
   00640 Propanoate metabolism
    RPC_1036
   00650 Butanoate metabolism
    RPC_1036
  Lipid metabolism
   00071 Fatty acid degradation
    RPC_1036
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RPC_1036
   00310 Lysine degradation
    RPC_1036
   00360 Phenylalanine metabolism
    RPC_1036
   00380 Tryptophan metabolism
    RPC_1036
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    RPC_1036
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    RPC_1036
   00281 Geraniol degradation
    RPC_1036
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RPC_1036
   00627 Aminobenzoate degradation
    RPC_1036
   00930 Caprolactam degradation
    RPC_1036
Enzymes [BR:rpc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     RPC_1036
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1136785..1137561
Genome map
AA seq 258 aa AA seqDB search
MAENVIIVEREGRVGLVTLNRPEMLNALNDELMDALGTALRDFDADDDIGAIVIAGSARA
FAAGADIAVMAEWSYSDVYKSNFVTRNWETIRQVRKPVLASVAGLAYGGGCELALACDII
VAARSAKFALPEIKLGLLPGAGGTQRLPRAIGKAKAMDMCLSGRPLEADEADCYGLVSRV
VDDDKLREETLKLAMTIASFSAPALMVLKETLNRAFETPLSEGILFERREMHARFAAPDA
REGITAFLEKRKPNFTHR
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
gtggcagagaacgtgatcatcgtcgaacgagaaggccgagtcggactcgtcacgctcaac
cgcccggagatgctcaacgcgctcaacgacgagttgatggatgcgctcggcacggcactg
cgcgatttcgacgccgacgatgacatcggcgccatcgtgatcgccggcagcgcgcgggcc
ttcgccgcgggcgccgatatcgccgtcatggccgagtggagctacagcgacgtctacaag
tcgaacttcgtcacccggaactgggagaccatccggcaggtgcgcaaaccggtgctggcc
tcggtcgcgggtctggcctatggcggcggatgcgaattggcgctggcctgcgacatcatc
gtcgccgcgcgcagcgccaaattcgcgctgccggagatcaagcttggcctattgcccggc
gccggcggcacccagcggctgccgcgcgccatcggcaaggccaaggcgatggacatgtgc
ctgtccggccgtccgctcgaggccgacgaggccgactgctacgggctggtgtcgcgcgtg
gtcgatgacgacaagctccgcgaagagaccttgaagcttgcgatgaccatcgcgtcgttc
tccgcccccgcattgatggtgctgaaggaaaccctcaatcgcgcgttcgagacgccgctg
agcgagggcatattgtttgaacggcgggaaatgcatgcccggttcgcggcgccggatgcc
cgcgaaggcatcacggcatttctggagaagcggaagccgaacttcacccatcgctga

DBGET integrated database retrieval system