KEGG   Rhodopseudomonas palustris BisB18: RPC_1251Help
Entry
RPC_1251          CDS       T00336                                 

Gene name
bchD
Definition
magnesium chelatase subunit D
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
rpc  Rhodopseudomonas palustris BisB18
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rpc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    RPC_1251 (bchD)
Enzymes [BR:rpc01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     RPC_1251 (bchD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1366685..1368484
Genome map
AA seq 599 aa AA seqDB search
MSQAVAWSDAATAAQLFAVDPVGTGVLLRSRAGPVRDRWLAMLRAALPPNDAHKHLPLHI
AEGRLLGGLDLSATLVSGRPVAERGLLAEADGGVLMLAMAERMQSSTTVHVTAAMDAHET
LIERDGLSLRMPARFGVVALDEGLEDEFAPAGLRDRLAFHLDLDRFSFRDTEEFEINGAD
IEVARSRLPLIRATDEQIEAIVTAAAAMGIVSLRAPLLTIRVARAAAAWSGHTEIDQEDI
SIAARLVLAPRALYFPQAEQPDQPEPPPEEPPPPEDNSEDNKDQDEQQIPDIDRALDEVI
LAAAKAAIPPDVLASLRASAGRTRARSSGKAGELQKSNKRGRPTGTVRGELRAGAKLSVI
ETLRSAAPWQPLRRREAAATAAEAIAAGGKAAPQPRILIRKDDFRIARFKQRTETITIFV
VDASGSAALHRLAEAKGAVELLLADCYVRRDQVAMIAFRGTIAEILLPPTRSLARAKRSL
AGLPGGGGTPLACGLDAAYALADSIKRKGQTPTVILMTDGRANIARDGAPGRPKAEEDAI
ASARQLRAANINAVLVDMSPRPGPQGEKIAKEMGARYLPLPYADATVLSQAVLASTQAA
NT seq 1800 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaggccgtcgcatggtccgatgcggccaccgcggcgcaattgttcgcggtcgat
ccggtcggcaccggcgtcttgttgcgttcgcgcgccgggccagtgcgcgaccgctggctg
gcgatgctgcgcgccgccttgccgcccaacgacgcccataagcacctgccgctgcatatc
gccgagggccggctgctcggcggcctcgatttgtcggcgacgctggtctccggccgtccg
gtcgccgaacgcgggttgctggccgaggccgacggcggcgtgttgatgctggcgatggcc
gagcggatgcaatcctcgaccacggtgcacgtcaccgcggcgatggacgcccatgagacg
ctgatcgagcgcgacgggctgtcgctgcggatgcctgcgcggttcggcgtggtggcgctc
gacgagggcctggaagacgaattcgccccggccgggttgcgcgaccggctggcgttccac
ctcgacctcgaccgcttctcgttccgcgacaccgaggaattcgagatcaatggtgccgac
atcgaagtggcgcgctcgcggttgccgctgatccgcgccaccgacgagcagatcgaggcg
atcgtcaccgcggctgcggcgatgggcatcgtctcgctgcgcgcgcccttgttgaccatc
cgcgtcgcccgcgccgccgcggcctggagcggccacaccgagatcgaccaggaagacatt
tcgattgcggcgcgcctggtgctggcgccacgtgcgctgtacttcccgcaggccgaacag
ccggaccagccggagccgccgccggaagaaccgccgccgccggaggacaattccgaggac
aacaaggaccaggacgagcagcagattccggacatcgaccgcgcactcgacgaggtgatc
ctggctgctgcgaaggcggcgatcccgcccgacgtgctggcctcgctgcgcgcctccgcg
ggccgcacccgcgcgcgctcctccggcaaggccggcgagctgcagaaatccaacaagcgc
ggccggccgaccggcacggtgcgcggcgaactgcgcgccggcgccaagctcagcgtgatc
gagacgctgcgctcggcagcgccctggcagccgctgcgccgccgcgaagccgctgccacc
gccgcagaggcgatcgccgccggcggcaaggcggcgccgcagccgcgcatcctgatccgc
aaggacgatttccgcatcgcgcggttcaagcagcgcaccgagaccatcaccatcttcgtg
gtcgacgcctcgggctcggcggcgctgcatcggctcgccgaagccaagggcgcggtggag
ctgttgctggcggattgctatgtgcgccgcgaccaggtggcgatgatcgcgttccgcggc
accatcgccgaaatcctgctgccgccgacgcgctcgctggcgcgcgccaagcgcagcctc
gcggggcttcccggcggcggcggcacgccgctggcctgcgggctggatgccgcctacgcg
ctggcggattccatcaagcgcaagggccagacgcccaccgtgatcctgatgaccgacggc
cgcgccaacatcgcccgcgatggcgcgcccggccggccgaaggccgaggaagacgccatc
gcctcggcgcggcaattgcgcgccgccaatatcaacgcggtgctggtcgatatgtcgccg
cggccggggccgcagggcgagaagatcgccaaggagatgggcgcgcgctatctgccgctg
ccctatgccgacgccaccgtgctgtcgcaggcggtgctggcgagcacccaggcggcgtag

DBGET integrated database retrieval system