KEGG   Rhodopseudomonas palustris BisB18: RPC_1315Help
Entry
RPC_1315          CDS       T00336                                 

Gene name
bchH
Definition
magnesium chelatase subunit H (EC:6.6.1.2)
Orthology
K03403  
magnesium chelatase subunit H [EC:6.6.1.1]
Organism
rpc  Rhodopseudomonas palustris BisB18
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rpc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    RPC_1315 (bchH)
Enzymes [BR:rpc01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     RPC_1315 (bchH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1429934..1433677
Genome map
AA seq 1247 aa AA seqDB search
MPKRTSPADATPLRVVIVTMDSHLSGAAARARNLLRRDYPGIELTVHSADEWGTDEGALG
RCYADIATGDIVIATMLFLDDHVRAVMPALLARRLDCDAMICCMSAAEVVKLTRVGKFDM
SAEALGAINWLKKLRGKKESGPAGKGEMKMLRQLPKLLRFIPGTAQDMRAYFLTLQYWLA
GSEQNIANMVRLLVDRYASGPRKGLRGIAKAEPPVEYADIGVYHPRMKGRIAESVDKLPT
IPNQQGTVGVLLLRSYLLAGNSGHYDGMIEAFEAKGLRVIAAFASGLDQRPAIEKFFMKD
GRSAVDAVVSLTGFSLVGGPAYNDSKAAEDILATLDVPYLSAHPVEFQTLEQWGASDRGL
MPVESTIMVAIPELDGCTGPMVYGGRSDAGEVPCAGCDRACKFTRSENGGDMYTCAERAE
VLASRTAKLVALRRSERKDRKVAVVLFNFPPNSGHIGTAAFLGVFESVYRTLQAMQREGY
QVELPANSDELRERIITGNAQRFGSDANVHARVMAGDHVKNERWLREIEGQWGPAPGKHQ
SDGSSIFVLGERFGNVFVGVQPAFGYEGDPMRLLFEKGFAPTHAFSAFYRWLKEDFGAHA
VLHFGTHGALEFMPGKQTGLSGACWPDRMIGDLPNVYLYASNNPSEGSIAKRRSAATLIS
YLTPPVAHAGLYRGLVELKSSIERWRGLSPDDEAERADLAVLIQAQASALDLATAEPAWG
DAAVATIAKLSEDVLEMEYALIPHGLHVVGENPTFEQRVEMLQAVADASHGIRPEQSVIE
GLVRGERPEHVVVGSGPEAEANIAIYKQLAATDRLLAEDHEIPSLIHALDGGFIRPAPGG
DLLRTPAILPTGRNLHGFDPFRIPSAFAVQDGAAQAQRLIEKHMEGGNGLPESVAIVLWG
TDNLKNEGAPIGQALALLGARPRFDSYGRLTGAELIPLGELGRPRIDVIITMSGIFRDLL
PLQIKLLAEACFLAASADEPTDFNFVRRHSLAYMEQHKCDMETASLRVFGNADGAYGSNV
NHLVENSRWEDEDELAETYTRRKSFAYGMKGQPVQQADLLKSALADVDLAYQNLDSVELG
VTTVDHYFDTLGGISRAVRRAKGGTAAPVYIGDQTRGAGTVRTLSEQVALETRTRMLNPK
WYEGMLKHGYEGVRQIEEHVTNTMGWSATTGEVAPWVYRQLTETFVLDPEMRARLAALNP
VASAKVANRLIEAHERNYWSPDPEMLEVLRKAGEELEDRLEGVGVAA
NT seq 3744 nt NT seq  +upstreamnt  +downstreamnt
atgccaaagcgcacttctcccgctgacgctacgccgttacgtgtcgtcatcgttacgatg
gacagtcatctgtccggcgcggccgcccgcgcgcgtaatctgttgcggcgtgattatccc
gggatcgaactgacggtgcattccgccgacgagtggggcaccgacgagggcgcgctcggc
cgttgctacgccgatattgccaccggcgacatcgtgatcgccaccatgctgttcctcgac
gaccacgttcgcgcggtgatgccggcgctgctggcgcgtcgcctggactgcgacgccatg
atctgctgcatgtcggcggccgaggtggtgaagctgacccgggtcggcaagttcgacatg
agcgccgaggcgctcggcgccatcaactggctgaagaagctgcgcggcaagaaggaatcc
ggtccggccggcaagggcgagatgaagatgctgcggcagctgccgaagctgctgcgcttc
attcccggcaccgcgcaagatatgcgcgcctacttcctgacgctgcaatattggctcgcc
ggctccgagcagaacatcgccaacatggtgcgcttgctggtcgatcgctacgccagcggc
ccgcgcaagggcctgcgcggcatcgccaaggccgagccgccggtcgaatacgccgatatc
ggcgtgtatcacccgcggatgaagggccggatcgcggaatccgtcgataagctgccgacc
attccgaaccagcagggcaccgtcggcgtgctgttgttgcgctcctatctactggccggc
aattccggtcactatgacggcatgatcgaggcgttcgaggccaaggggctgcgcgtcatc
gcggcgttcgccagcggtctcgatcagcgtccggcgatcgaaaagttcttcatgaaggac
ggccgcagcgccgtcgatgcggtggtttcactgaccggcttctcgctggtcggcggccct
gcctacaacgattccaaggcggccgaagacattctggcgacgctcgacgtgccgtatctg
tcggcgcatccggtggaattccagactctcgaacaatggggcgcctccgaccgcggcttg
atgccggtcgagagcaccatcatggtggcgatccccgaactcgacggctgcaccggcccg
atggtctatggcggccgttccgacgccggcgaagtgccgtgcgcgggctgcgatcgggct
tgcaagttcacccgttcggaaaacggcggcgacatgtacacctgcgccgaacgcgccgag
gtgttggcgtcccgcaccgccaagctggtggctttgcgccgcagcgagcgcaaggaccgc
aaggtcgcggtggtgctgttcaacttcccgccgaactccggccatatcggcaccgcggct
ttcctcggggtgttcgagtcggtgtaccgcacgctgcaagcgatgcagcgcgagggctat
caggtcgagcttcccgccaattccgacgagttgcgcgagcgcatcatcaccggcaacgcc
cagcgcttcggctccgatgccaatgtgcatgcgcgggtgatggctggcgatcacgtcaag
aacgagcgttggctgcgcgagatcgaaggccagtggggtccggcgccaggcaagcatcag
agcgacggcagctcgatcttcgtgctcggcgagcgcttcggcaacgtgttcgtcggtgtg
cagccggcgttcggttacgaaggcgatccgatgcgccttttgttcgaaaagggctttgcg
ccgacgcacgcgttctcggcgttctatcgctggctgaaagaagatttcggcgcccacgcg
gtgctgcatttcgggacccatggcgccttggagttcatgcccggcaagcagaccggcctg
tccggcgcctgctggcccgaccgcatgatcggcgatctgccgaacgtctatctctatgcc
tcgaacaatccgtcggaaggctcgatcgccaagcggcgctccgccgcgacgctgatcagc
tacctgaccccgccggtggcgcatgccggcctgtatcgcgggctggtcgagctgaaatcc
tcgatcgagcgctggcgcggcctgtcgccggacgacgaggcggaacgcgccgatctcgcg
gtgctgattcaggcgcaggccagcgcgctcgaccttgcgacagccgagccggcctggggc
gatgccgccgtcgccaccatcgcgaaattgtccgaagacgtgctggaaatggaatacgcg
ctgattccgcacggactgcatgtggtcggcgaaaatccgacgttcgagcagcgggtggaa
atgctgcaagcggtggccgatgcctcgcacggcattcgccccgaacagtcggtgatcgaa
gggctggtccgcggcgagcggccggagcacgtggtggtcggatcggggcccgaggccgag
gccaatatcgcgatctacaagcaattggcggccaccgaccggctcttggccgaggatcat
gaaattcccagcctgatccacgccctggacggcgggttcatccgtccggcgcccggcggc
gatctgttgcgcacgccggcgattctgccgaccggccgcaatctgcacggcttcgatccg
ttccggatccccagcgcgtttgcggtgcaggacggcgcggcgcaggcgcagcggctgatc
gaaaagcacatggaaggcggcaacggcctgccggagtcggtcgccatcgtgttgtggggc
accgacaacctgaagaacgaaggcgcgccgatcggccaggctctggccttgctcggtgcc
cggccgaggttcgacagctacggccggctgaccggcgccgaactgatcccgctcggcgaa
ctcggccggccgcgcatcgatgtcatcatcaccatgtcgggcattttccgcgacctgttg
ccgctgcagatcaagcttttggcagaggcttgcttcctcgcggcctcggccgatgagccg
accgacttcaacttcgtgcgccggcattcgctggcgtatatggaacaacacaagtgcgac
atggagaccgcgtcgctgcgggtgttcggcaacgccgacggcgcctacggctccaacgtc
aaccatctggtcgagaacagccgctgggaagacgaggacgaactcgccgagacctacacc
cgccgcaagagcttcgcttacggcatgaagggccagccggtgcagcaggccgatctgttg
aagagcgcgctcgccgacgtcgatctggcctaccagaatctcgactccgtcgaactcggc
gtcaccacggtcgatcactatttcgacacgctgggcggcatcagccgcgcggtgcgccgc
gccaaaggcggcaccgcggcccccgtctatatcggcgaccagacccgcggcgccggcacg
gtgcgaaccttgtcggagcaggtggcgctggagacgcgcacccgcatgctcaatccgaaa
tggtacgaaggcatgctgaagcacggctacgaaggtgtgcggcagatcgaagaacacgtc
accaacaccatgggctggtccgcgaccaccggcgaggtggcgccgtgggtgtatcgccag
ctcaccgaaaccttcgttctcgaccccgaaatgcgcgcgcgtcttgcggccctcaacccg
gtggcgtcggcgaaagtcgccaatcgcctgatcgaggcacacgaacgcaattactggtct
cccgacccggaaatgctcgaggtcctgcgcaaggcaggcgaagagcttgaggatcgcctt
gaaggcgtaggagttgccgcatga

DBGET integrated database retrieval system