KEGG   Rhodopseudomonas palustris BisB18: RPC_1379Help
Entry
RPC_1379          CDS       T00336                                 

Definition
isocitrate lyase (EC:4.1.3.1)
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
rpc  Rhodopseudomonas palustris BisB18
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:rpc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RPC_1379
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    RPC_1379
Enzymes [BR:rpc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     RPC_1379
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1504447..1506084
Genome map
AA seq 545 aa AA seqDB search
MNFQPRGISDSAIQKPASYQSQIEAAAALLKDKDTWNGVKAEAVARMRLQNRFKTGLDVA
RYTAALMRADMAAYDADSTKYTQSLGCWHGFIAQQKLISVKKHFGTTDRTYLYLSGWMIA
ALRSEFGPLPDQSMHEKTSVPALIEELYTFLRQADSRELNAIFRELDAARKAGDTAKETA
LIEKIDNFQTHVVPVIADIDAGFGNAEATYLLAKKMIEAGACALQIENQVSDEKQCGHQD
GKVTVPHEVFLAKIRACRHAFLELGVEDGVIVTRTDSLGAGLTQQIAVSHQPGDLGDQYN
SYLDCDEVDATSVGNGDVIISRGGKLLRPKRLPSNLYQFREGTGADRCVLDCITSLQNGA
DLLWIETEKPNIAQIASMVDRIREVIPNAKLAYNNSPSFNWTLNFRWQVYDEMQKAGKDV
SAYNRAELMKAEYDNTPLGLEADELIRTFQAESAKRAGIFHHLITLPTYHTAALSTDNLA
REYFGEQGMLGYVKNVQRQEIRQGIACVKHQDMAGSNIGDDHKEYFAGEAALKAGGAHNT
MNQFG
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atgaacttccagccacgtgggatcagcgattcggccatccagaagcccgcctcctatcag
agccaaatcgaagccgccgcagcgctcctgaaggacaaggacacctggaatggcgtgaag
gccgaggccgtggcgcggatgcgcctgcagaaccgtttcaagaccgggctcgacgtcgcg
cgctacaccgccgcgctgatgcgcgccgacatggcggcctatgacgccgacagcaccaaa
tacacccagtcgctgggctgctggcacggcttcatcgcgcagcagaagctaatctcggtg
aagaagcatttcggcaccaccgaccgcacctatctgtatctgtccggctggatgatcgcg
gcgctgcgctccgaatttggaccgctgcccgatcagtcgatgcacgagaagacctcggtg
ccggcgctgatcgaagagctctacacctttctgcggcaggcggattcccgcgaactcaac
gcgattttccgtgagctcgacgccgcccgcaaggccggcgacaccgccaaggaaaccgcg
ctgatcgagaagatcgacaatttccagacccacgtcgtgccggtgatcgccgacatcgac
gccggcttcggcaatgccgaggcgacctatctgctggccaagaagatgatcgaagccggc
gcctgcgcgctgcagatcgagaaccaggtgtcggacgaaaagcagtgcggtcaccaggac
ggcaaggtcacggtgccgcacgaggtcttcctggcgaagatccgcgcctgccgccacgcc
ttcctcgagctcggcgttgaagacggcgtcatcgtcacccgcaccgactcgctcggcgca
ggtctcacccagcagatcgcggtcagccatcagccgggcgacctcggcgaccagtacaac
agctacctcgattgtgacgaggtcgacgcgacctcggtcggcaatggcgacgtcatcatc
agccgcggcggcaagctgctgcgtccgaagcggctgccgagcaacctataccagttccgc
gaaggcaccggtgcggatcgctgcgtgctcgattgcatcacctcgctgcagaacggcgcc
gacctgttgtggatcgagaccgagaagccgaacatcgcgcagatcgcctcgatggtcgat
cggatccgcgaagtgatcccgaacgccaagctcgcctacaacaactcgccatcgttcaac
tggacgctgaacttccgctggcaggtctacgacgagatgcagaaggcggggaaggacgtc
agtgcgtacaaccgtgccgagctgatgaaggcggagtacgacaacaccccgctgggtctc
gaggccgacgagctgatccgcaccttccaggcggaatcggccaagcgcgccgggatcttc
catcatctgatcacgttgccgacctatcacacggcggcgctgtcgaccgacaatctcgcc
cgcgagtatttcggcgagcagggcatgctgggttatgttaagaatgtgcagcgccaggaa
atccgtcagggcatcgcctgcgtcaagcatcaggacatggccggctcgaacatcggcgac
gaccacaaggaatacttcgccggcgaggccgctctgaaggccggcggcgcgcacaacacg
atgaaccagttcggataa

  All links  
No link information was found.   
DBGET integrated database retrieval system