KEGG   Rhodopseudomonas palustris BisB18: RPC_1765Help
Entry
RPC_1765          CDS       T00336                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
rpc  Rhodopseudomonas palustris BisB18
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:rpc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    RPC_1765
Enzymes [BR:rpc01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     RPC_1765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1917031..1917888)
Genome map
AA seq 285 aa AA seqDB search
MIATTTRPAAAAAPPGHPLLQNLLARPVAAVMGVLNVTPDSFSDGGRFLAPDEALAQAAK
LIADGADIIDIGAESTRPYGSQPVSAAEEIARLRPVLADVVALGTPVSIDSMKAEVVAFA
FEQGVAIANDVWGLQRDPQMAGVIAERGAPVIVMHNRDAVDPALDILKDIAEFFARSLEI
AAKAGIPQSHIVLDPGIGFGKTPEQSLATLARLDELSVFGLPLLVGASRKRFISTVSPSE
PRQRLGGSIAAHLLSAQRGAKIIRAHDVAETVQALRVAQAIEDRR
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgatcgcgacgacgacgaggcccgccgcagcggccgcaccgccaggtcatccgctgtta
cagaatttgctcgcgcggccggtggcggccgtgatgggcgtgctcaacgtcaccccggat
tcgttctccgatggcggccgctttctcgcgcccgacgaggcgctggcacaggccgcgaaa
ctgatcgccgacggcgccgacatcatcgacatcggcgcggaatccacccgcccctatggc
tcgcagccggtctccgccgcggaagagatcgcgcggttgcgcccggtgctggcggacgtc
gtggcgctcggcaccccggtgtcgatcgacagcatgaaggccgaggtggtggcgttcgcc
ttcgagcaaggcgtggcgatcgccaacgacgtctgggggctgcagcgcgatccgcagatg
gccggcgtgatcgccgaacgtggcgcgccggtgatcgtgatgcacaatcgcgacgcggtc
gatccggcgctcgatattctcaaagacatcgccgaattctttgcccgctcgctggagatc
gccgccaaggccgggattccgcaaagccacatcgtgctcgatcccggcatcggcttcggc
aagacgccggaacagagcctggcgaccttggcgcggctcgacgaactcagcgtattcggc
ctgccgctgctggtcggtgcctcgcgcaagcgcttcatcagcacggtgtcgccgtcggag
ccgcgccagcggctcggcggatcgatcgccgcgcatctgctgagcgcgcaacgcggcgcc
aaaatcattcgcgcccatgacgtcgccgagaccgtgcaggcgctccgcgtggcgcaggca
atcgaggaccgacgatga

  All links  
No link information was found.   
DBGET integrated database retrieval system