KEGG   Rhodopseudomonas palustris BisB18: RPC_1997Help
Entry
RPC_1997          CDS       T00336                                 

Definition
3-hydroxybutyrate dehydrogenase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
rpc  Rhodopseudomonas palustris BisB18
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rpc00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    RPC_1997
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    RPC_1997
Enzymes [BR:rpc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     RPC_1997
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2172794..2173573
Genome map
AA seq 259 aa AA seqDB search
MKNRNALVTGSTSGIGLATARELANRGCHVMLNGFGDAGEIDRLCAEIAARSGTKVVHSG
ADLSRPEEIRTMLAQADEALGPLDIVVNNAGTQHVSPVQNFPDEKWDLLLAVNLSAAFHI
IKAVVPGMMQRGWGRIVNTSSVLGMVGAPHKPAYVASKHGLIGLTKSVAIEVAEHGVTCN
AVCPGTVLTAIIEKQIAQQALATGLREDQVMKEVFLREIPTKKIIPPEHLAATIAFLCSE
EAGSITGAAIAVDGGYTAH
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgaagaacagaaatgcacttgtcaccggctccacaagtggaatcggtctggcgaccgcg
cgcgaactggccaatcgtggctgccacgtcatgctcaacggcttcggtgacgccggggag
atcgatcggctgtgcgccgagatcgccgcgcgcagcgggaccaaggtcgtccactccggc
gccgacctcagccggccggaagaaatccgcactatgctggcgcaggcggacgaagccttg
ggcccgctcgacatcgtggtgaacaacgccggcacgcagcatgtctcgccggtgcagaac
tttcccgacgagaaatgggatctgttgctcgcggtgaatctgagcgctgcattccacatc
atcaaggccgtggtgcccgggatgatgcagcggggctgggggcggatcgtcaacacctcg
tcggtgctcgggatggtgggcgcgccgcacaagccggcctacgtcgcctcgaagcacggc
ctgatcggcctgaccaaatcggtggcgatcgaagtcgccgagcacggcgtcacctgcaac
gcggtgtgtccgggcacggtgctgaccgcgatcatcgaaaagcagatcgctcagcaagcg
ctggccaccggcctgcgtgaggatcaggtgatgaaggaagtcttcctccgcgaaatcccg
acgaaaaagatcatcccgcccgaacacctcgccgccaccatcgccttcctgtgctcggag
gaggccggctccatcaccggcgccgccatcgccgtggacggcggctacaccgcgcactga

DBGET integrated database retrieval system