KEGG   Rhodopseudomonas palustris BisB18: RPC_2168Help
Entry
RPC_2168          CDS       T00336                                 

Definition
FAD-dependent pyridine nucleotide-disulfide oxidoreductase
Orthology
K03885  
NADH dehydrogenase [EC:1.6.99.3]
Organism
rpc  Rhodopseudomonas palustris BisB18
Pathway
Oxidative phosphorylation
Brite
KEGG Orthology (KO) [BR:rpc00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    RPC_2168
Enzymes [BR:rpc01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.99  With other, unknown, acceptors
    1.6.99.3  NADH dehydrogenase
     RPC_2168
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2360058..2361428
Genome map
AA seq 456 aa AA seqDB search
MSASQETQKGSGMTELATAAERPHRIVVAGGGAGGLELVTKLGDTLGKQGLAKVTLVERS
RTHLWKPLLHSVAAGSLRRSQHELNYLAQAHWHNFVYRYGEVVGLDRAEKQLKLAAMFDE
EGREITPASSVPYDTLIMAIGSVTNDFGTPGAAEFAVPLETPEQASRFNRRIVNACLRAN
AQPDGPRPGQLHIAIIGAGATGTELAAELHHTVRDVVGYGMDRIDPSRDIHIVLIEAGPR
ILPALPERISIATKDLLSELGVEVRANARVAEVRADGVVLSSGEMIPSELVVWSAGVKAP
DFLADLDGLETNRINQLVVNPTLQTTRDPQIFAIGDCASCPRPGHDAPVPPRAQAAHQMA
THIIRNIAPIMAGQPVPPFEYRDFGSLVSLGKYSAVGNLMGYAIGRSMFIEGMFARLMYR
SLYKMHEAALHGRSTVFWRAMLSTISQRPTPSVKLH
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcttcgcaggaaacgcaaaagggcagcggcatgacggaactggcgacggcggcc
gaacggccgcaccgcatcgtggtggccggcggcggtgccggcgggctcgagctggtcacc
aagctcggcgatacgctgggcaagcagggcctcgccaaggtgaccctggtggagcgctcg
cgcacccatctgtggaagccgctgctgcattcggtggcggccggcagcctgcgtcgctcg
cagcacgagttgaactatctggcgcaggcgcattggcacaatttcgtctatcgctacggc
gaggtggtcgggctcgaccgcgccgagaagcaattgaagctggcggcgatgttcgacgag
gagggccgcgagatcacgccggcctcgtcggtgccctacgacacgctgatcatggcgatc
ggcagcgtcaccaatgatttcggcaccccgggcgccgccgaattcgcggtgccgctggaa
acccccgagcaggccagccgcttcaaccgccgcatcgtcaacgcctgcctgcgcgccaat
gcgcagccggatgggccgcggcccgggcagttgcacatcgccatcatcggcgccggcgcc
accggcaccgagcttgccgccgaactgcaccacaccgtgcgcgacgtggtcggctacggc
atggaccgcatcgatccgtcgcgcgacatccacatcgtgctgatcgaggcgggtccgcgc
attctgccggcgctgccggagcggatctcgatcgccaccaaggatctgttgagcgaactc
ggcgtcgaggtgcgcgccaacgcccgcgtcgccgaggtgcgcgccgacggcgtggtgctg
tcgagcggcgagatgatcccgtccgaactggtggtgtggtcggccggggtcaaggcgccg
gattttctcgccgacctcgacgggctggagaccaaccggatcaatcaactcgtcgtcaat
ccgacgctgcagaccacccgcgatccgcagatcttcgcgatcggcgattgcgcctcatgc
ccgcgcccgggccatgacgcgccggtgccgccgcgggcgcaagcggcgcaccagatggcg
acccacatcatccgcaacatcgcgccgatcatggcggggcagccggtcccgccgttcgag
tatcgcgatttcggctcgctggtgtcgctcggcaagtactccgcggtcggcaatctgatg
ggctatgcgatcggccgcagcatgttcatcgagggcatgttcgcacgcctgatgtatcgc
tcgctgtacaagatgcacgaagcggcgctgcacggccgctccacggtgttctggcgggcg
atgctgtcgaccatctcgcagcgcccgacgccgagcgtcaagctgcattga

DBGET integrated database retrieval system