KEGG   Rhodopseudomonas palustris BisB18: RPC_2168Help
Entry
RPC_2168          CDS       T00336                                 

Definition
FAD-dependent pyridine nucleotide-disulfide oxidoreductase
Orthology
K03885  
NADH dehydrogenase [EC:1.6.99.3]
Organism
rpc  Rhodopseudomonas palustris BisB18
Pathway
Oxidative phosphorylation
Class
Metabolism; Energy metabolism; Oxidative phosphorylation [PATH:rpc00190]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2360058..2361428
Genome map
AA seq 456 aa AA seqDB search
MSASQETQKGSGMTELATAAERPHRIVVAGGGAGGLELVTKLGDTLGKQGLAKVTLVERS
RTHLWKPLLHSVAAGSLRRSQHELNYLAQAHWHNFVYRYGEVVGLDRAEKQLKLAAMFDE
EGREITPASSVPYDTLIMAIGSVTNDFGTPGAAEFAVPLETPEQASRFNRRIVNACLRAN
AQPDGPRPGQLHIAIIGAGATGTELAAELHHTVRDVVGYGMDRIDPSRDIHIVLIEAGPR
ILPALPERISIATKDLLSELGVEVRANARVAEVRADGVVLSSGEMIPSELVVWSAGVKAP
DFLADLDGLETNRINQLVVNPTLQTTRDPQIFAIGDCASCPRPGHDAPVPPRAQAAHQMA
THIIRNIAPIMAGQPVPPFEYRDFGSLVSLGKYSAVGNLMGYAIGRSMFIEGMFARLMYR
SLYKMHEAALHGRSTVFWRAMLSTISQRPTPSVKLH
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcttcgcaggaaacgcaaaagggcagcggcatgacggaactggcgacggcggcc
gaacggccgcaccgcatcgtggtggccggcggcggtgccggcgggctcgagctggtcacc
aagctcggcgatacgctgggcaagcagggcctcgccaaggtgaccctggtggagcgctcg
cgcacccatctgtggaagccgctgctgcattcggtggcggccggcagcctgcgtcgctcg
cagcacgagttgaactatctggcgcaggcgcattggcacaatttcgtctatcgctacggc
gaggtggtcgggctcgaccgcgccgagaagcaattgaagctggcggcgatgttcgacgag
gagggccgcgagatcacgccggcctcgtcggtgccctacgacacgctgatcatggcgatc
ggcagcgtcaccaatgatttcggcaccccgggcgccgccgaattcgcggtgccgctggaa
acccccgagcaggccagccgcttcaaccgccgcatcgtcaacgcctgcctgcgcgccaat
gcgcagccggatgggccgcggcccgggcagttgcacatcgccatcatcggcgccggcgcc
accggcaccgagcttgccgccgaactgcaccacaccgtgcgcgacgtggtcggctacggc
atggaccgcatcgatccgtcgcgcgacatccacatcgtgctgatcgaggcgggtccgcgc
attctgccggcgctgccggagcggatctcgatcgccaccaaggatctgttgagcgaactc
ggcgtcgaggtgcgcgccaacgcccgcgtcgccgaggtgcgcgccgacggcgtggtgctg
tcgagcggcgagatgatcccgtccgaactggtggtgtggtcggccggggtcaaggcgccg
gattttctcgccgacctcgacgggctggagaccaaccggatcaatcaactcgtcgtcaat
ccgacgctgcagaccacccgcgatccgcagatcttcgcgatcggcgattgcgcctcatgc
ccgcgcccgggccatgacgcgccggtgccgccgcgggcgcaagcggcgcaccagatggcg
acccacatcatccgcaacatcgcgccgatcatggcggggcagccggtcccgccgttcgag
tatcgcgatttcggctcgctggtgtcgctcggcaagtactccgcggtcggcaatctgatg
ggctatgcgatcggccgcagcatgttcatcgagggcatgttcgcacgcctgatgtatcgc
tcgctgtacaagatgcacgaagcggcgctgcacggccgctccacggtgttctggcgggcg
atgctgtcgaccatctcgcagcgcccgacgccgagcgtcaagctgcattga

DBGET integrated database retrieval system