KEGG   Rhodopseudomonas palustris BisB18: RPC_2231Help
Entry
RPC_2231          CDS       T00336                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
rpc  Rhodopseudomonas palustris BisB18
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rpc00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    RPC_2231
Enzymes [BR:rpc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     RPC_2231
Exosome [BR:rpc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RPC_2231
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2433552..2435141
Genome map
AA seq 529 aa AA seqDB search
MRCDSLLPILTSCAQSAAVDAPSLASRKNAMSYVLAIDQGTTSSRAIVFRQDISIAAQAQ
QEFPQHFPASGWVEHEPEDIWVSTLTTCRAALAQAGLSASDIAAIGITNQRETTVVWDRA
TGQAVHRAIVWQDRRTAAACAQLKADGHEPMVAAKTGLIVDPYFSGTKVAWILDHVPGAR
ARAERGELLFGTVDCYLLWRLTGGKIHATDATNASRTLLFNIHTGQWDDELLALLGVPRS
MLPEVRDSSHHFGDSEPDLFGGAIAIRGIAGDQQAATIGQACFAPGMMKSTYGTGCFALL
NTGAVAVKSQHQLLTTIAYQLNGVRTYALEGSIFVAGSAVQWLRDGLHIIDHASETGPLA
DKSDSLQSVYLVPAFVGLGAPYWNPRVRGALFGLTRNTGPAELAHAALESVCYQTYDLWA
AMRADWPDADEASIVLRVDGGMTASDWTMQRLADLLDAPVDRPMIAETTALGAGYLAGLS
AGIFPEPQQFADNWRLQHRFRPVMSKATRARKLKGWAAAVRGLLASDDE
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
gtgcgttgcgactctcttttgcccatcttgacctcttgcgcgcaatcggctgctgttgac
gcaccatccctcgcgtcacggaagaacgccatgtcctatgtgctggccatcgatcagggc
accacctcgtcgcgcgccatcgtgtttcgtcaggacatctcgatcgcagcacaagcgcag
caggaattcccgcagcattttccggcctccggctgggtcgaacacgagcccgaggacatt
tgggtgtcgacgctgaccacctgccgcgccgcgctcgcccaggccgggctcagcgcctcc
gacatcgcggcgatcggcatcaccaaccagcgcgagaccaccgtggtgtgggaccgcgcc
accgggcaggcggtgcaccgcgccatcgtctggcaggatcgccgcaccgcagccgcctgc
gcgcagctcaaggccgacggccacgagccgatggtggcggccaagaccgggctgatcgtc
gatccgtatttctccggcaccaaggtggcgtggatcctcgaccacgtccccggcgcccgc
gcccgcgccgagcgcggcgaattgttgttcggcaccgtcgattgctatctgttgtggcgg
ctgaccggcggcaaaatccacgccaccgacgccaccaacgcctcgcgcacgctgctgttc
aacatccacaccgggcaatgggacgacgagctgctggcgctgctgggcgtgccgcgctcg
atgctgccggaggtgagagactcttcgcatcatttcggcgacagcgagccggacttgttc
ggcggcgccattgccattcgcggcatcgccggcgatcagcaggccgccaccatcggccag
gcctgctttgcgcccggcatgatgaaatcgacctacggcaccggctgcttcgcgctgctc
aacaccggcgcggtggcggtgaaatcccagcaccagctgctcaccaccatcgcctatcag
ctgaacggcgtgcgcacctacgcgctggaaggctcgatctttgtcgcagggagcgccgtg
caatggctgcgcgacgggctgcatatcatcgatcatgcctctgagaccgggccgctcgcc
gacaaatcggattcgctgcagagcgtctatctggtgccggccttcgtcgggctcggcgcg
ccgtattggaatccgcgggtccgcggcgcgttgttcgggctgacccgcaacaccggcccg
gcggagctcgcgcatgcagctctcgagagcgtgtgctaccagacctacgacctgtgggcg
gcgatgcgcgccgattggccggacgccgacgaggcgtcgatcgtgctgcgggtcgacggc
ggcatgaccgcatcggactggaccatgcagcggctcgccgatctgctcgacgccccggtc
gaccggccgatgatcgccgagaccaccgcgctcggcgccggctatctcgccggcctcagt
gccgggatctttccggagccgcagcaattcgccgacaattggcggctgcaacatcgcttc
cgtccggtgatgagcaaggcgacccgcgcgcgcaagctgaaaggctgggccgccgcggtg
cgcgggctgctcgccagcgacgacgagtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system