KEGG   Rhodopseudomonas palustris BisB18: RPC_2466Help
Entry
RPC_2466          CDS       T00336                                 

Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
rpc  Rhodopseudomonas palustris BisB18
Pathway
rpc00400  Phenylalanine, tyrosine and tryptophan biosynthesis
rpc01100  Metabolic pathways
rpc01110  Biosynthesis of secondary metabolites
rpc01130  Biosynthesis of antibiotics
rpc01230  Biosynthesis of amino acids
Module
rpc_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rpc00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    RPC_2466
Enzymes [BR:rpc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     RPC_2466
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS
Motif
Other DBs
NCBI-ProteinID: ABD88017
UniProt: Q215B9
Position
complement(2673608..2674426)
Genome map
AA seq 272 aa AA seqDB search
MSDILTKIEAYKREEIAAAKRARPLAELAAAAKTASPPRGFVAAIREKLAGGDTALIAEI
KKASPSKGLIRADFDPPALAKAYQQGGAACLSVLTDTPSFQGSLDYLVAARAAVTLPVLR
KDFMFDTYQVVEARAHGADCILIIMAALDDAAAQDIEDAAIALGMDVLIEIHNRDELERA
LKLRSPMIGVNNRNLRSFEVTLATSEALAPLIPADRLMVGESGIFAPADIARLERVGIAT
FLVGESLMRQHDVAAATRTLLARDSLRTTGTR
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacatcctgaccaagatcgaagcctataagcgcgaggaaatcgcggccgccaag
cgcgcgcggccgctcgccgaactggcggccgcggcgaagaccgcctcgccgccgcgcggc
ttcgtcgcagcgatccgcgaaaaactcgccggcggcgacaccgcgctgatcgccgagatc
aagaaggcctcgccgtcgaaaggcctgatccgcgccgatttcgatccgccggcgctcgcc
aaggcctatcagcaaggcggcgccgcctgcctgtcggtgttgaccgacacgccgtcgttc
cagggcagcctcgattatctcgtcgcggcgcgcgccgcggtgacgctgccggtgctgcgc
aaggatttcatgttcgacacctatcaggtggtggaagcccgcgcccatggcgccgactgc
atcctgatcatcatggcggcactcgacgatgccgcggcgcaagacatcgaggatgccgcg
atcgcgcttggcatggacgtgctgatcgagatccacaaccgcgacgaactcgagcgcgcg
ttgaaacttcgctcgccgatgatcggcgtcaacaaccgcaatctgcgcagcttcgaggtc
acgctggcgaccagcgaagccttggcgccgctgattcccgccgaccggctgatggtcggc
gaaagcggcatctttgcgcccgccgacatcgcccggcttgaacgggtcggcattgcgacc
ttcctggtcggcgaaagcctgatgcggcagcacgacgtcgccgcggcgacgcggacgctg
ctggcgcgggactcgcttcgtaccaccggaacgcggtag

DBGET integrated database retrieval system