KEGG   Rhodopseudomonas palustris BisB18: RPC_2471Help
Entry
RPC_2471          CDS       T00336                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
rpc  Rhodopseudomonas palustris BisB18
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Class
Metabolism; Overview; Carbon metabolism [PATH:rpc01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:rpc01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:rpc00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:rpc00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:rpc00562]
Metabolism; Energy metabolism; Carbon fixation in photosynthetic organisms [PATH:rpc00710]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2678616..2679389
Genome map
AA seq 257 aa AA seqDB search
MSAAIRPLIAGNWKMNGLRASLSELKLMLEGAGKLSATADLLICPPATLVAAFAQKLAAD
TGSRSNSFAIGAQDCHPRASGAHTGDISAEMLADAGASAVIVGHSERRADHGESDALVRE
KAEAAWRAGLVAIICVGETQGQRDAGQTLDVVGTQLAGSLPDGATAANTVVAYEPVWAIG
TGRTPTVADVEQVHGFIRKSLTQRMSGEGSKVRILYGGSVKPSNAQELMAVADVNGALVG
GASLKAGDFLAIAAGCP
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgtcagctgcgattcgaccgttgattgccggaaactggaaaatgaacgggttgcgggcg
tcgctgtccgaactgaagctgatgctggaaggcgccggcaagctgtcggccaccgccgac
ttgctgatctgtccgccggcgacgctggttgcggcattcgcccagaagctcgccgccgac
accggatcgcgatcgaattccttcgccatcggcgcacaggattgccatccgagagcttcc
ggcgcccacaccggcgacatctcggcggaaatgctggcggacgccggcgccagcgcggtg
atcgtcgggcattccgagcgccgcgccgaccatggcgagagcgacgccttggtgcgggag
aaggccgaggcggcctggcgcgccgggctggtcgcgatcatctgcgtcggcgagacgcag
ggccagcgcgacgccggccagaccctcgatgtggtcggcacccagctcgccggctcgctg
cccgatggcgccaccgccgccaacacggtggtggcttacgagccggtctgggcgatcggc
accgggcgcacgcccacggttgcggatgtcgagcaggttcatggctttatccgcaagtcg
ctcacccaacggatgagcggcgaggggagcaaggttcggatcctctatggcggctcggtg
aagccgtcgaacgcccaggaattgatggcggtggccgacgtcaacggcgcgctggtcggc
ggcgccagcctgaaagccggcgattttcttgcgattgcggccggctgtccctaa

DBGET integrated database retrieval system