KEGG   Rhodopseudomonas palustris BisB18: RPC_2510Help
Entry
RPC_2510          CDS       T00336                                 

Definition
Beta-N-acetylhexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
rpc  Rhodopseudomonas palustris BisB18
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rpc00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    RPC_2510
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    RPC_2510
Enzymes [BR:rpc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     RPC_2510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2722769..2723797
Genome map
AA seq 342 aa AA seqDB search
MMNRRAFITGVSGTVLTAEERAFIRTTRPWGFILFKRNIDTPQQVSKLVAELRAEADFPE
APVLIDQEGGRVQRLGPPHWPVYPPGAIFSTLYDIDSQLGLAAARLSARLIAADLIDLGI
TVDCLPLADVPVAGADAVIGNRAYGNEPGKVAAIARAVTDGLAQGGVLPVLKHIPGHGRA
TADTHHALPVVDTPLAELQRTDFAAFQPLADLAMAMTAHVVFSDLDAAQPATTSATIIER
VIRGTIGFQGLLMSDDVSMNALAGTIAERSRAIVAAGCDMLLHCNGKLDEMQAVAAEAPW
LVDEAKARADRALAQRQQPQPFDRIAARNELDALIGRAGVGA
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgatgaacaggcgcgcatttattaccggtgtgtccggcaccgttttgaccgccgaggaa
cgcgcgttcattcgcacgacccggccgtggggttttatcctcttcaagcgcaatatcgat
acgcctcagcaagtctcgaaacttgttgcggaattgcgcgcggaggcggacttccccgag
gccccggtgctgatcgaccaggagggcggacgggtgcagcggctcggcccgccgcactgg
ccggtgtatccgccgggggcgatcttctccacgctctacgatatcgattcgcagctcggc
ctcgccgcggcgcggctcagcgcgcggctgatcgcggccgatctgatcgatctcggcatc
acggtggactgcctgccgctggccgacgtgccggttgcgggcgccgacgcggtgatcggc
aatcgcgcctatggcaacgagccgggcaaggtcgcggcgatcgcccgcgccgtcaccgac
ggcctggcgcagggcggcgtgctgccggtcctgaagcacattcccggccatggccgcgcc
accgccgacacccaccatgcgctgccggtggtcgacaccccgctggccgagctgcagcgc
accgacttcgccgccttccagccgctggccgatcttgcgatggcgatgaccgcacatgtt
gtgtttagcgacctcgatgccgcccaacccgcgaccacttctgcgacaatcatcgaacgt
gtgattcgcgggacgatcgggttccaggggctattgatgagcgacgacgtctcgatgaat
gcgctggccggaacgatcgccgagcgcagccgcgccatcgttgcggccggctgcgacatg
ctgctgcactgcaacggcaagctcgacgaaatgcaggcggtggccgccgaggcgccgtgg
cttgtcgacgaagccaaggcgcgcgccgaccgcgcgctggctcagcgtcagcaaccgcag
ccgttcgaccgcatcgcggcacgcaatgaactcgacgccctgatcggccgagctggagtg
ggcgcatga

DBGET integrated database retrieval system