KEGG   Rhodopseudomonas palustris BisB18: RPC_2521Help
Entry
RPC_2521          CDS       T00336                                 

Definition
protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
rpc  Rhodopseudomonas palustris BisB18
Brite
Enzymes [BR:rpc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     RPC_2521
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2732348..2732998
Genome map
AA seq 216 aa AA seqDB search
MPIGPPPPEKMMFQLSLRRRGISDQAVLRAMDEVPRDAFVEPGQRAEAWLDTALPIACGQ
TISQPFVVAYMTEQMQLRPEHRVLEIGTGSGYQAAILSRLSRAVLTLERFKTLADQARAR
LAALHCDNVEVRIGDGFAVPADAGLFDRIIVTAAMEEVPASLLDRLDLDGVLIAPVGPHN
ATQTLLRIRKSKSGIERKELVAVRFVPALPGLAREL
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgcccatcggaccgccgccgcctgaaaagatgatgttccagctcagtctgcggcgtcgc
ggcatcagcgatcaagcggtactgcgggcgatggacgaggtgccgcgcgacgccttcgtc
gagccggggcagcgcgccgaggcctggctggacaccgcgctgccgatcgcctgcggccag
accatcagccagccgttcgtggtcgcctatatgaccgagcagatgcagctgcgccccgag
caccgggtgctcgagatcggcaccgggtcgggctaccaggcggcgatcctgtcgcggctc
agccgcgcggtgctgacgctggagcgcttcaagacgctggccgatcaggcgcgggcccgg
cttgcggcgctgcattgcgataatgtcgaggtgcggatcggcgacggcttcgcggtgccg
gccgacgccgggctgttcgaccgcatcatcgtcaccgccgcgatggaagaggtcccggcg
tcgctgctcgacaggctcgacctcgacggcgtgctgatcgccccggtcggtccgcacaac
gccacccagaccttgctgcggattcgcaaatccaaaagcggcatcgagcgcaaggagctg
gtcgcggtccgcttcgtgccggcgctgccggggctggcgcgcgaactgtag

DBGET integrated database retrieval system