KEGG   Rhodopseudomonas palustris BisB18: RPC_2567Help
Entry
RPC_2567          CDS       T00336                                 

Definition
protein-L-isoaspartate(D-aspartate) O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
rpc  Rhodopseudomonas palustris BisB18
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2785884..2786549
Genome map
AA seq 221 aa AA seqDB search
MPDFSTARRFMVDGQIRPSSVTDWRIIDAMRAVPREAFVPESQSALAYLDLDLDVSEAGP
VKRYLLKPAVTARLLQSANLQPTDRVLVVGCATGYLPAIVARLVDQVVATESEASMAAEA
SQILGTLGVSNVRVQQAGSAEGFPATAPYDAIILNGATELVPLELYRQLQDGGRLVGVFA
LGRTPRAEIVTRSDDDFGSRPLFDTSVPVLPGLERPKGFVF
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgcccgatttctcgaccgcccgacggttcatggtggatggtcagatccggccgagcagc
gtcaccgactggagaatcatcgacgcgatgcgcgcggtgccgcgcgaagcctttgtgccg
gagagccagagcgcactggcctatctcgacctcgacctcgacgtcagcgaagccggtccg
gtcaaacgctacctgctgaaacccgcggtcaccgcgcgactgctgcaatcggccaatctg
cagccgaccgatcgtgtgttggtggtcggctgtgccaccggctatctgccggcgatcgtc
gcccggcttgtggaccaggttgtcgccaccgagagcgaagccagcatggcggccgaagcc
agccagattctcggaacgctcggcgtcagcaacgtccgggtgcagcaggccggctcggcc
gagggctttccggccaccgccccttacgacgccatcattctgaacggcgccaccgaactc
gtgccgcttgaattataccggcaactccaggacggcggacggctggttggggtgttcgcg
ctcggccgcacgccgcgcgcggaaatcgtgacgcggtccgacgacgacttcggcagccgg
ccgttgttcgatacctcggttccggttctgcctgggctggaacgccccaagggcttcgtt
ttctaa

DBGET integrated database retrieval system