KEGG   Rhodopseudomonas palustris BisB18: RPC_2834Help
Entry
RPC_2834          CDS       T00336                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
rpc  Rhodopseudomonas palustris BisB18
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3076008..3077075
Genome map
AA seq 355 aa AA seqDB search
MIAPRDEHERTMAYAEVALRQIRSLRQDALPRNYEIWYVYATGHNAPLNKIINETLARSG
KLSESDLEQIYDTYLSHGRTTDRIDKIGARVVSEIEDVMSLITDALGLTASFGDNLSGAN
QKLSLAKDRAQVKAVVERLVASTREMQQANNALETRLSTSKLEINNLQHNLEAIRAESLT
DPLTGLGNRKHFDRAVDDAVRCASASRQPLALLMIDIDHFKSFNDTYGHLTGDQVLRLVG
MSLKQSINGQDIMARYGGEEFAVVLPNTGLRQAIAVAENIRQTVTSKELKKKSTGEILGR
VTISVGVSTLRADDDTDSLIERADSCLYAAKRNGRNRVICEIDRDDLDHDRIQVA
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
gtgattgcacccagggacgagcacgaacgcaccatggcctatgccgaggtggcgttgcgt
cagatcagatcgttgcggcaggatgcgctgccgcgcaactacgagatctggtacgtctat
gcgaccgggcacaatgccccgctcaacaagatcatcaacgaaacgctggcgcgcagcggc
aagctgagcgagtccgacctcgaacagatctacgacacctatttgtcgcatggtcgtacc
accgaccgcatcgacaagatcggcgcccgcgtcgtcagtgaaatcgaggacgtgatgtcg
ctgatcaccgacgcgctcggcttgaccgcgagtttcggcgacaatctcagcggcgccaat
cagaagctgtcgctcgccaaggatcgcgcccaggtcaaggcggtggtcgaacggctggtg
gcctcgacccgggaaatgcagcaggccaacaacgcgctggagacccggctgtcgacctcg
aagctcgagatcaacaatttgcagcacaatctcgaggcgatccgcgccgaaagcctcacc
gatcccttgaccggtctcggcaaccgcaagcacttcgaccgcgcggtcgacgacgccgtg
cgctgcgcctcggcgagccggcaaccgctggcgctgctgatgatcgacatcgatcacttc
aagtcgttcaacgacacctatggccacctcaccggcgaccaggtgctgcggctggtcggc
atgtcgctgaagcagagcatcaacggccaggatatcatggcccgttacggcggcgaggaa
ttcgccgtggtgctgcccaacaccgggctgcggcaggcgatcgcggtcgcggagaacatc
cgccagaccgtgacctccaaggaactgaagaagaagtccaccggggaaattctcggccgc
gtcaccatctcggtcggagtgtcgacgctgcgagccgacgacgataccgactcgctgatc
gagcgcgccgacagctgcctctacgccgccaagcgcaacggccgcaaccgagtgatctgc
gaaatcgaccgcgacgacctcgaccacgaccgcatccaggtggcgtga

DBGET integrated database retrieval system