KEGG   Rhodopseudomonas palustris BisB18: RPC_2974Help
Entry
RPC_2974          CDS       T00336                                 

Definition
(GenBank) Alcohol dehydrogenase, zinc-binding
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
rpc  Rhodopseudomonas palustris BisB18
Pathway
rpc00010  Glycolysis / Gluconeogenesis
rpc00071  Fatty acid degradation
rpc00350  Tyrosine metabolism
rpc00625  Chloroalkane and chloroalkene degradation
rpc00626  Naphthalene degradation
rpc01100  Metabolic pathways
rpc01110  Biosynthesis of secondary metabolites
rpc01120  Microbial metabolism in diverse environments
rpc01130  Biosynthesis of antibiotics
rpc01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rpc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RPC_2974
  Lipid metabolism
   00071 Fatty acid degradation
    RPC_2974
  Amino acid metabolism
   00350 Tyrosine metabolism
    RPC_2974
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    RPC_2974
   00626 Naphthalene degradation
    RPC_2974
Enzymes [BR:rpc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     RPC_2974
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_zinc_N_2 ADH_N adh_short AlaDh_PNT_C ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: ABD88519
UniProt: Q213B7
Position
complement(3254469..3255482)
Genome map
AA seq 337 aa AA seqDB search
MRAVVLHEHGDNDKLQFVADYPTPKAGEGDVVVKVKASSINYHDVFTRRGMPGIKVPLPV
IIGLDVVGEISELGAGVEGWKLGDRVLIDPVNRVEGGLMGETQDGGLAEYCRAKAHQLVK
IPDAVTFEQAAALPVAYGTAIRMMNTIGKIKAGEKVLILGASGGVGVCCVQLAKLAGAYV
IACAGSEEKGRRLTELGADEIILYTQADFMKTVFERHGKPHRRRFVESGGVDVVVNFTGG
DTWVKSMRVLKVGGRLLTCGATAGYSPQEDLRFIWTFELQILGSNGWERDDLPKLFDLVE
SGKLKVLIDKSYPLEEAKEAVRVIEDRAVFGKVVVTP
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcggtggtccttcacgaacatggtgacaacgacaaattgcaattcgtcgcggat
tatccgacgccgaaagccggcgagggcgacgtcgtcgtcaaggtgaaggcttcttcgatc
aattatcacgacgtcttcacccgtcgcggcatgccgggcatcaaggtgccgctgccggtg
atcatcgggctcgacgtggtcggtgagatcagcgaactcggtgccggcgtcgaaggctgg
aagctcggcgaccgggtattgatcgatccggtcaaccgcgtcgagggcggcctgatgggc
gagacccaggacggcggcctggcggaatactgccgcgccaaagcgcaccagttggtgaag
attcccgacgcggtgacgttcgagcaggcggcggcgttgccggtggcctacggcaccgcg
atccggatgatgaacaccatcggcaaaatcaaggctggtgaaaaggtcttgatcctcggc
gccagcggcggcgtcggcgtgtgctgcgtgcagctcgccaagctggccggcgcctatgtg
atcgcctgcgccggcagcgaagagaagggccgacggctcaccgaactcggcgccgatgag
atcatcctctacacccaagccgatttcatgaagacggtgttcgagcgccacggcaagccg
catcgccggcgtttcgtcgaaagcggcggcgtcgacgtggtggtgaacttcaccggcggc
gacacctgggtgaaatcgatgcgcgtgctcaaggtcggcggcaggttgctgacctgcggc
gccaccgccggctattcgccgcaggaagatctgcgcttcatctggactttcgagctgcag
atcctcggctccaacggctgggagcgcgacgacctgccgaagctgttcgatctggtcgag
agcggcaagctcaaggtcttgatcgacaaatcctatccgttggaggaggcgaaagaggcg
gtgcgggtgatcgaagaccgcgcggtgttcggcaaagtcgtggtgacgccatga

DBGET integrated database retrieval system