KEGG   Rhodopseudomonas palustris BisB18: RPC_3738Help
Entry
RPC_3738          CDS       T00336                                 

Definition
superoxide dismutase (EC:1.15.1.1)
Orthology
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
rpc  Rhodopseudomonas palustris BisB18
Brite
Enzymes [BR:rpc01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     RPC_3738
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4163308..4163907)
Genome map
AA seq 199 aa AA seqDB search
MTFTLPDLPYAYDALAPYMSKETLEYHHDKHHQAYVTNGNNLLKGTEFEGKSLEEVVKGS
FGKNAPLFNNAAQHYNHIEFWKWMKPNGGGDKLPGRLEKKITEDLGGLEKFKTDFAAAGV
GQFGSGWAWLSVSKDGKLEITKTPNGENPLVHGATPLLGVDVWEHSYYIDYRNKRPDYLK
AFVDHLINWDYVDELFSKV
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgaccttcacgctgcccgacctgccttacgcctatgacgcgctcgcgccgtatatgtcg
aaagaaacccttgagtaccaccacgacaagcatcaccaagcctatgtcaccaatggaaat
aacctgctgaagggcaccgaattcgaaggcaaatcgctcgaggaagtcgtcaaaggctcg
ttcgggaagaatgcgccgctgttcaacaacgccgcccagcactacaaccacatcgaattc
tggaagtggatgaagccgaacggcggcggcgacaaattgcccggccggttggagaagaag
atcaccgaggatctcggcggcttggaaaaattcaagaccgatttcgccgccgccggcgtc
ggtcagttcggctccggttgggcctggctgtcggtcagcaaggacggcaagctggaaatc
accaagaccccgaacggcgagaatccgctggtgcacggcgccacgccgctgctcggcgtc
gacgtctgggagcattcctactacatcgactaccgcaacaagcgcccggattatctcaag
gccttcgtcgatcacctgatcaactgggactatgtcgacgagctgttctccaaggtttga

  All links  
No link information was found.   
DBGET integrated database retrieval system