KEGG   Rhodopseudomonas palustris BisB18: RPC_3778Help
Entry
RPC_3778          CDS       T00336                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
rpc  Rhodopseudomonas palustris BisB18
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rpc00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    RPC_3778
Enzymes [BR:rpc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     RPC_3778
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4200463..4201458)
Genome map
AA seq 331 aa AA seqDB search
MNSHQIRRLAADYGIAAEFVDARGNTVIVDDDVLRKLLASMGVLRPDRGRGVVTPRSAMF
PPAIVVRAEKGRIAIDLGDQVPQGPVAWQVTFESGKRRRGETEPTRALDVSARQLILSDI
PYGYHELLLQAHNARTTLIVTPGRCWLPENVARGGRSFGISLQLYLLRSARNWGIGDFGD
LAQFAKLSAKHGCDVLGLNPLHQMFPDKPEHASPYSPASRHFLNVLYIDVVAIPEFRHSE
RARQLLEQPAFSDRLTRCRATSQIDYSLANALKLQALWLAYEDFRSAASQARNSAFQSFV
EQAGEALRNSSLFQALRDHFTSTICSTSTIR
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
gtgaattcacaccagatcaggcggctcgcagcggactacggcatcgccgccgagttcgtc
gatgcgcgcggcaacacagtgatcgtcgacgacgacgtgctgcgcaaattgctggccagc
atgggcgtgctgcgtcccgatcgcgggcggggcgtggtcacgccgcgttccgcgatgttt
ccgcccgcgatcgtggtccgcgccgagaagggccgaatcgccatcgatctcggcgaccag
gttccgcaaggcccggtcgcctggcaagtgacgttcgagagcggcaagcgccgtcgcggc
gagaccgaaccgacccgtgcgctcgacgtttccgcgcgccagctgatcctgtccgacatc
ccctacggctatcacgagttgctgctgcaagcgcacaacgcgcggaccacgctgatcgtg
acgccggggcgctgctggttgcctgagaacgtcgcgcgcggcggtcgctcgttcggcatt
tcgctgcaactctatctgctgcgctcggcgcgcaattgggggatcggcgacttcggcgac
ttggcgcaatttgccaagctgtcggcgaagcacggctgcgacgtgctcggcctcaatccg
ctgcatcagatgtttccggacaagccggagcacgccagtccctattcaccggcgagccgc
cattttctcaacgtattgtacatcgacgtggtcgcgatcccggaattccggcattcggaa
cgggcccgccaattgctggagcagccggcgttcagcgaccgcctcacgcgctgccgcgcc
acctcgcaaatcgactacagcctggccaacgcgctcaagctgcaagcgttgtggctggcc
tatgaggatttccgctccgcggccagtcaggcgcggaacagcgcgttccaaagcttcgtc
gaacaggccggcgaagccctgcgcaacagctcgttgtttcaggcgctgcgcgatcatttc
acctcgacgatctgctcgacgagcacgatccggtga

DBGET integrated database retrieval system