KEGG   Rhodopseudomonas palustris BisB18: RPC_4022Help
Entry
RPC_4022          CDS       T00336                                 

Definition
(RefSeq) malate synthase G (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
rpc  Rhodopseudomonas palustris BisB18
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:rpc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RPC_4022
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    RPC_4022
   00630 Glyoxylate and dicarboxylate metabolism
    RPC_4022
Enzymes [BR:rpc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     RPC_4022
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4471330..4473492
Genome map
AA seq 720 aa AA seqDB search
MNRIKAHGLQIAPVLFDFIAKEAAPKTGIDPDAFWAGLAGIVRDLAPKTRELLALRDALQ
LKIDDWHKANKGKPWDIEAYTAFLKEIGYLLPEPATVEVETTDVDEEIGKICGPQLVVPL
SNARYSLNAANARWGSLYDALYGTDAIPHDASETGRGYNKARGAKVIAKAKAFLDQAVPL
ATASHTDVTSYSVIAGHLSVKLKSGNATALKNAAQFAGFLGDAAAPTAILLVNHGMHIEI
KVDRSSVIGKDDAAGVADVILESAVSTILDMEDSVAAVDAEDKVLIYRNVLGLMDGTLTA
DFEKGGKTLTRALNGDRVYQTVDGKGLTLHGRSLLLMRNVGHHMFTDAVLDESGAEIPEG
FLDAAVAGLLAIHDLKGGSKTRNSRTGSVYIVKPKMHGPDEVALTVELFGRVEQMLGLAE
NTMKVGIMDEERRTTVNLKACIQNASKRIVFINTGFLDRTGDEIHTSMEAGPMIRKNEMK
AQPWIKAYEDWNVDMGLIDGLPGHAQIGKGMWAAPDKMADMLAQKVGHPQAGATTAWVPS
PTAATLHALHYHQVDVLKRQQELKTGGPRAKLSDILTIPVSQSNWAPDDVRQEIDNNCQG
ILGYVVRWIDQGVGCSKVPDIHDVGLMEDRATLRISSQHLANWLHQGVITKEQVMESLKR
MAVVVDKQNEGDALYKPMAPGFDGVAFKAACDLIFKGREQPNGYTEFILTARRREAKAAV
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgcatcaaagcccacggcctgcagattgcgccagttctgttcgacttcatcgcc
aaggaggccgcccccaagaccggcatcgatccggatgcgttctgggccggcctggccggc
atcgtgcgcgacctggcaccgaagacccgcgagctgctggcgctgcgcgacgcgctgcag
ctcaagatcgacgattggcacaaagccaacaagggcaagccctgggatatcgaggcctac
accgcgttcctgaaagagatcggctatctgttgccggagccggccaccgtcgaagtcgag
acgaccgatgtcgacgaggagatcggcaagatctgcggcccgcagctggtggtgccgctc
agcaacgcgcgctactcgctgaacgccgccaacgcgcgctggggctcgctgtacgacgcg
ctgtacggcaccgatgcgatcccgcatgacgcttcggagaccggccgcggttacaacaag
gcgcgcggcgccaaggtaatcgccaaggcgaaagccttcctcgaccaagcggtgccgctg
gcgaccgccagccacaccgatgtgacgtcctacagcgtgatcgccggtcatctgtcggtg
aagctgaagagcggcaacgccaccgcgctgaagaacgccgcgcagttcgccggcttcctc
ggcgatgcagcggcaccgaccgcgatcctgctggtcaaccacggcatgcatatcgaaatc
aaggtcgatcgctccagcgtgatcggcaaggacgatgctgccggcgtcgccgacgtgatc
ctggaatcggccgtctccaccattctcgacatggaagactcggtcgccgctgtcgacgcc
gaagacaaggtgctgatctatcgcaacgtgctcggcctgatggatggcacgctcaccgcc
gacttcgagaagggcggcaagacgctgacccgcgcgctgaacggcgaccgcgtgtaccag
accgtcgacggcaagggcctgacgctgcacggtcgcagcctgttgctgatgcgcaatgtc
ggccatcacatgttcaccgacgcggtgctcgacgaatccggcgcagagatccccgaaggc
ttcctcgacgccgcggtcgccggcctgctggcgattcacgacctcaagggtggctccaag
acccgcaacagccgcaccggctcggtctatatcgtcaagccgaagatgcacggccccgac
gaggtggcgctgaccgtcgaattgttcggccgtgtcgagcagatgctcggccttgcggag
aacaccatgaaggtcggcatcatggacgaggagcgccgcaccacggtcaacctcaaggcc
tgcatccagaatgcgtcgaagcgcattgtgttcatcaacaccggcttcctcgatcgcacc
ggcgacgagatccacacctcgatggaagcgggcccgatgatccgcaagaacgagatgaag
gcgcagccctggatcaaggcctatgaagactggaacgtcgacatgggactgatcgatggc
ctgcccggccacgcccagatcggcaagggcatgtgggcggcgcccgacaagatggcggac
atgctggcgcagaaggtcggccatccgcaggccggcgccaccaccgcctgggtgccctcg
cccaccgccgcgacgctgcacgcgctgcattatcaccaggtcgacgtgctgaagcggcag
caggagttgaaaaccggcggtccgcgcgccaaactcagcgacatcctcaccatcccggtg
tcgcagtcgaactgggcgccggacgacgtccgccaagagatcgacaacaactgccagggc
attctcggctatgtggtgcgctggatcgaccagggcgtcggctgctccaaggtgccggac
atccacgacgtcggactgatggaagaccgcgccacgctgcggatctccagccagcatctg
gcgaattggctgcatcagggtgtcatcaccaaggagcaggtgatggagtccttgaagcgg
atggctgtggtggtcgacaagcagaacgaaggcgacgcgctgtacaagccgatggcgccc
ggcttcgacggcgtggcgtttaaggccgcctgcgacctgatcttcaagggccgcgagcag
ccgaacggctataccgagttcatcctcaccgcgcggcgccgcgaagccaaggccgcggtg
tga

DBGET integrated database retrieval system