KEGG   Rhodopseudomonas palustris BisB18: RPC_4022Help
Entry
RPC_4022          CDS       T00336                                 

Definition
malate synthase G (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
rpc  Rhodopseudomonas palustris BisB18
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:rpc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RPC_4022
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    RPC_4022
   00630 Glyoxylate and dicarboxylate metabolism
    RPC_4022
Enzymes [BR:rpc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     RPC_4022
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4471330..4473492
Genome map
AA seq 720 aa AA seqDB search
MNRIKAHGLQIAPVLFDFIAKEAAPKTGIDPDAFWAGLAGIVRDLAPKTRELLALRDALQ
LKIDDWHKANKGKPWDIEAYTAFLKEIGYLLPEPATVEVETTDVDEEIGKICGPQLVVPL
SNARYSLNAANARWGSLYDALYGTDAIPHDASETGRGYNKARGAKVIAKAKAFLDQAVPL
ATASHTDVTSYSVIAGHLSVKLKSGNATALKNAAQFAGFLGDAAAPTAILLVNHGMHIEI
KVDRSSVIGKDDAAGVADVILESAVSTILDMEDSVAAVDAEDKVLIYRNVLGLMDGTLTA
DFEKGGKTLTRALNGDRVYQTVDGKGLTLHGRSLLLMRNVGHHMFTDAVLDESGAEIPEG
FLDAAVAGLLAIHDLKGGSKTRNSRTGSVYIVKPKMHGPDEVALTVELFGRVEQMLGLAE
NTMKVGIMDEERRTTVNLKACIQNASKRIVFINTGFLDRTGDEIHTSMEAGPMIRKNEMK
AQPWIKAYEDWNVDMGLIDGLPGHAQIGKGMWAAPDKMADMLAQKVGHPQAGATTAWVPS
PTAATLHALHYHQVDVLKRQQELKTGGPRAKLSDILTIPVSQSNWAPDDVRQEIDNNCQG
ILGYVVRWIDQGVGCSKVPDIHDVGLMEDRATLRISSQHLANWLHQGVITKEQVMESLKR
MAVVVDKQNEGDALYKPMAPGFDGVAFKAACDLIFKGREQPNGYTEFILTARRREAKAAV
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgcatcaaagcccacggcctgcagattgcgccagttctgttcgacttcatcgcc
aaggaggccgcccccaagaccggcatcgatccggatgcgttctgggccggcctggccggc
atcgtgcgcgacctggcaccgaagacccgcgagctgctggcgctgcgcgacgcgctgcag
ctcaagatcgacgattggcacaaagccaacaagggcaagccctgggatatcgaggcctac
accgcgttcctgaaagagatcggctatctgttgccggagccggccaccgtcgaagtcgag
acgaccgatgtcgacgaggagatcggcaagatctgcggcccgcagctggtggtgccgctc
agcaacgcgcgctactcgctgaacgccgccaacgcgcgctggggctcgctgtacgacgcg
ctgtacggcaccgatgcgatcccgcatgacgcttcggagaccggccgcggttacaacaag
gcgcgcggcgccaaggtaatcgccaaggcgaaagccttcctcgaccaagcggtgccgctg
gcgaccgccagccacaccgatgtgacgtcctacagcgtgatcgccggtcatctgtcggtg
aagctgaagagcggcaacgccaccgcgctgaagaacgccgcgcagttcgccggcttcctc
ggcgatgcagcggcaccgaccgcgatcctgctggtcaaccacggcatgcatatcgaaatc
aaggtcgatcgctccagcgtgatcggcaaggacgatgctgccggcgtcgccgacgtgatc
ctggaatcggccgtctccaccattctcgacatggaagactcggtcgccgctgtcgacgcc
gaagacaaggtgctgatctatcgcaacgtgctcggcctgatggatggcacgctcaccgcc
gacttcgagaagggcggcaagacgctgacccgcgcgctgaacggcgaccgcgtgtaccag
accgtcgacggcaagggcctgacgctgcacggtcgcagcctgttgctgatgcgcaatgtc
ggccatcacatgttcaccgacgcggtgctcgacgaatccggcgcagagatccccgaaggc
ttcctcgacgccgcggtcgccggcctgctggcgattcacgacctcaagggtggctccaag
acccgcaacagccgcaccggctcggtctatatcgtcaagccgaagatgcacggccccgac
gaggtggcgctgaccgtcgaattgttcggccgtgtcgagcagatgctcggccttgcggag
aacaccatgaaggtcggcatcatggacgaggagcgccgcaccacggtcaacctcaaggcc
tgcatccagaatgcgtcgaagcgcattgtgttcatcaacaccggcttcctcgatcgcacc
ggcgacgagatccacacctcgatggaagcgggcccgatgatccgcaagaacgagatgaag
gcgcagccctggatcaaggcctatgaagactggaacgtcgacatgggactgatcgatggc
ctgcccggccacgcccagatcggcaagggcatgtgggcggcgcccgacaagatggcggac
atgctggcgcagaaggtcggccatccgcaggccggcgccaccaccgcctgggtgccctcg
cccaccgccgcgacgctgcacgcgctgcattatcaccaggtcgacgtgctgaagcggcag
caggagttgaaaaccggcggtccgcgcgccaaactcagcgacatcctcaccatcccggtg
tcgcagtcgaactgggcgccggacgacgtccgccaagagatcgacaacaactgccagggc
attctcggctatgtggtgcgctggatcgaccagggcgtcggctgctccaaggtgccggac
atccacgacgtcggactgatggaagaccgcgccacgctgcggatctccagccagcatctg
gcgaattggctgcatcagggtgtcatcaccaaggagcaggtgatggagtccttgaagcgg
atggctgtggtggtcgacaagcagaacgaaggcgacgcgctgtacaagccgatggcgccc
ggcttcgacggcgtggcgtttaaggccgcctgcgacctgatcttcaagggccgcgagcag
ccgaacggctataccgagttcatcctcaccgcgcggcgccgcgaagccaaggccgcggtg
tga

DBGET integrated database retrieval system