KEGG   Rhodopseudomonas palustris BisB18: RPC_4089Help
Entry
RPC_4089          CDS       T00336                                 

Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
rpc  Rhodopseudomonas palustris BisB18
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:rpc00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4542803..4544344)
Genome map
AA seq 513 aa AA seqDB search
MTSADAPRPQLKIRLIHLDTGRENVAVMSRRSKALRPEVFSGFSRVEIRRNAKSVLATLL
ITDDDALVGPDELGLAEPAFRRFGEPAGTFVTVSPATPPDSLDAVRGKIQGRTLSAAEIT
AIVNDLTRYRYSDMEIAAFLIGAARFMTSDELLALVSAMASVGTQLRWDRPIVVDKHCIG
GIPGNRTSMILVPIVAAHGLTIPKTSSRAITSPAGTADTMEVLARVDVSVAEMKEIVAAC
NGCLIWGGHVNLSPADDILISVERPLCLDTREQMVASIMSKKLAAGSTHLLVDLPVGPTA
KVASALDAMRLRKLFEFVGDHFGIAVETITTDGRQPIGNGIGPVLEAQDVMAVLGNDPKA
PADLREKSLRLAAHLLEYDPHLRGGAGYARARELLESGAALKQMQKIIDNQGPSTCHKDL
GTLTAEVTAERDGVVSAIDCLQLNRLARTAGAPIDKGAGIRLFKKVGDRVEAGEPLYRIY
AFDPAERELAVAAAKLACGYTVDDAQTFREQVM
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgaccagcgccgacgcgccccgcccgcaactcaagatccgcctgatccatctcgacacc
ggccgcgaaaacgtcgcggtgatgtcgcggcgctcaaaggcgctgcgcccggaggtgttc
agcggcttcagccgggtcgagatccgccgcaatgcgaagtcggtgctggcgaccttgctg
attaccgacgacgacgcgctggtcgggccggacgaactcggcctcgccgagccggcgttc
cggcgtttcggcgaacccgccgggaccttcgtcacggtgtcgccggcgacgccgccggac
agtctcgacgcggtgcgcggcaagatccagggccgcacgctgagcgcggcggagatcacc
gccatcgtcaacgatctcacccgctatcgttattccgacatggagatcgccgccttcctg
atcggcgcggcgcggttcatgacttcggacgaactgctggcgctggtgtcggcgatggcc
tcggtcggcactcagttgcgctgggatcgcccgatcgtggtcgacaagcattgcatcggc
ggcattcccggcaatcgcacctcgatgatcctggtgccgatcgtcgccgcgcacgggctg
acgattccgaaaacctcgtcgcgcgccatcacctcgccggccggcaccgccgataccatg
gaggtgttggcgcgggtcgatgtcagcgtcgcggaaatgaaagagatcgtcgccgcctgc
aacggctgtctgatctggggcggccacgtcaatctctcgcccgccgatgacatcttgatc
tcggtggagcggccgctgtgtctcgacacccgcgagcagatggtggcctcgatcatgtcg
aagaagctcgccgccggctcgacgcatctgttggtcgatctgccggtcggcccgaccgcc
aaggtcgccagcgcactcgacgcgatgcggctgcgcaagctgttcgaattcgtcggcgat
catttcggcatcgcggtggagaccatcaccaccgacggccggcagccgatcggcaacggc
atcggcccggtgctggaggcgcaggacgtcatggcggtgctcggcaacgatccgaaggct
cccgccgatctgcgcgaaaaatcgctacggttggcggcgcatctgttggaatacgatccg
catctgcgcggcggcgcgggctacgcgcgggcccgcgagttgctggaaagcggcgcggcg
ctgaagcagatgcagaagatcatcgacaatcaggggccttcgacctgtcacaaggacctc
ggaacgctgaccgccgaggtgacggcggagcgcgacggcgtggtgtcggcgatcgattgc
ctgcagctcaatcggctggcgcgcaccgccggcgcgccgatcgacaagggcgccggcatc
cggctgttcaagaaggtcggcgatcgtgtcgaggccggcgagccgctgtatcgaatttac
gccttcgatccggccgagcgcgaactcgcggtggctgccgccaagctcgcctgcggttac
acggtcgacgacgcgcaaacctttcgcgagcaggtgatgtag

DBGET integrated database retrieval system