KEGG   Rhodopseudomonas palustris BisB18: RPC_4165Help
Entry
RPC_4165          CDS       T00336                                 

Definition
(GenBank) Uroporphyrinogen III synthase HEM4
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
rpc  Rhodopseudomonas palustris BisB18
Pathway
rpc00860  Porphyrin and chlorophyll metabolism
rpc01100  Metabolic pathways
rpc01110  Biosynthesis of secondary metabolites
rpc01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rpc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    RPC_4165
Enzymes [BR:rpc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     RPC_4165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: ABD89690
UniProt: Q20YU6
Position
4628677..4629519
Genome map
AA seq 280 aa AA seqDB search
MVERLDGYRILILETREEAQFARLLTEQGAAVLQCPMFAIHDAPDPAPVEAWIRRCIAQP
FDDLVLTTGEGLRRLVKAARRIELGEPLIAAIGQSRSFARGPKPGRALREIGLEASIVTE
VPTSEGIAATLKAVDLRGRRLGLQLYPDKDHSVLIAAITAGGASVDPVLPYVYDARAAES
NVLAAIDAMAAGSIDALALTSSGQIRRLIDVARAHHCEPRLREALAATPIASVGPVVSEE
LKSYGLRTDIYPANDAFFMKPLISAMATALNARKPRAAAQ
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atggtcgaacggctggacggctaccgcattctgatcctggaaacccgggaagaagcccag
ttcgcgcggcttttgaccgaacagggcgccgcggtgctgcaatgcccgatgttcgccatc
cacgacgcgccggaccccgccccggtcgaagcctggatcagacgctgcatcgcgcagccg
ttcgacgatctggtgctgaccaccggcgaaggactgcgccggctggtgaaggcggcgcgg
cgcatcgagctcggcgagccgttgatcgccgcgatcggacagtcgcgaagctttgcgcgc
gggccgaagcccggccgggcgctgcgcgaaatcggcctggaggccagcatcgtcaccgaa
gtgccgacctcggagggcatcgccgcaacgctgaaagccgtcgaccttcgcggtcgaagg
ctcgggctgcagctctatccggacaaggaccatagcgtcttgatcgcggcgatcaccgcg
ggcggcgccagcgtcgacccggttttgccgtacgtctatgacgcccgcgccgccgagagc
aacgtgctggcggcgatcgacgcgatggcggcgggcagcatcgacgcgctggcgctgacc
agttcgggacagatccgccggctgatcgacgtggcgcgggcgcatcattgcgagccgcgg
ctgcgcgaggccttggcggcgacgccgatcgcttcggtcggcccggtggtctccgaggag
ttgaaatcctacgggctgcgcaccgacatctacccggccaacgacgccttcttcatgaag
ccgttgatcagcgcgatggcgaccgcgctcaatgcccgcaagccgcgcgccgcggcgcag
tga

DBGET integrated database retrieval system