KEGG   Rhodopseudomonas palustris BisB18: RPC_4207Help
Entry
RPC_4207          CDS       T00336                                 

Definition
(GenBank) dTDP-4-dehydrorhamnose 3,5-epimerase
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
rpc  Rhodopseudomonas palustris BisB18
Pathway
rpc00521  Streptomycin biosynthesis
rpc00523  Polyketide sugar unit biosynthesis
rpc01130  Biosynthesis of antibiotics
Module
rpc_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:rpc00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    RPC_4207
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    RPC_4207
Enzymes [BR:rpc01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     RPC_4207
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom
Motif
Other DBs
NCBI-ProteinID: ABD89731
UniProt: Q20YQ5
Position
4678392..4678946
Genome map
AA seq 184 aa AA seqDB search
MTIDELNIPGVVVLTPKRFADDRGWFMETYSHPALQALGIELDFVQDNHSLSLHTGTLRG
LHFQTPPHAQAKLVRCVRGRILDVAVDVRANSPTYGQYASAELSAADARQIFIPVGFAHG
FVTLEPDTEVVYKVSDIYAPQCDGGIRWNDPTIAFPWNIEHGPFLSPKDEKLPLLADFVS
PFRM
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgacgattgatgagttgaacatcccgggcgtagtcgtgctgacgccgaaacgctttgcc
gacgaccgcggctggttcatggaaacctacagccatccggcgctgcaagccctcggcatc
gagctcgatttcgtccaggacaaccactcgctgtcgctgcacaccggcacgttgcgcggc
ctgcatttccagaccccgccgcacgcccaggccaagctggtgcgctgcgtgcgcggccgc
attctcgacgtcgcggtcgacgttcgggccaattcgccgacctacggccaatacgcctcg
gccgaattgtcggccgccgacgcccggcaaatcttcatcccggtcggcttcgcgcacggc
ttcgtcacgctcgaaccggataccgaggtggtctacaaggtcagcgacatctacgctccg
caatgcgacggcggcatccgctggaacgaccccaccatcgccttcccttggaacatcgag
cacggcccgttcctctcgccaaaggacgaaaagctgccgctgctggcggattttgtcagt
ccgttccgaatgtga

DBGET integrated database retrieval system