KEGG   Rhodopseudomonas palustris BisB18: RPC_4207Help
Entry
RPC_4207          CDS       T00336                                 

Definition
dTDP-4-dehydrorhamnose 3,5-epimerase (EC:5.1.3.13)
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
rpc  Rhodopseudomonas palustris BisB18
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:rpc00523]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:rpc00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4678392..4678946
Genome map
AA seq 184 aa AA seqDB search
MTIDELNIPGVVVLTPKRFADDRGWFMETYSHPALQALGIELDFVQDNHSLSLHTGTLRG
LHFQTPPHAQAKLVRCVRGRILDVAVDVRANSPTYGQYASAELSAADARQIFIPVGFAHG
FVTLEPDTEVVYKVSDIYAPQCDGGIRWNDPTIAFPWNIEHGPFLSPKDEKLPLLADFVS
PFRM
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgacgattgatgagttgaacatcccgggcgtagtcgtgctgacgccgaaacgctttgcc
gacgaccgcggctggttcatggaaacctacagccatccggcgctgcaagccctcggcatc
gagctcgatttcgtccaggacaaccactcgctgtcgctgcacaccggcacgttgcgcggc
ctgcatttccagaccccgccgcacgcccaggccaagctggtgcgctgcgtgcgcggccgc
attctcgacgtcgcggtcgacgttcgggccaattcgccgacctacggccaatacgcctcg
gccgaattgtcggccgccgacgcccggcaaatcttcatcccggtcggcttcgcgcacggc
ttcgtcacgctcgaaccggataccgaggtggtctacaaggtcagcgacatctacgctccg
caatgcgacggcggcatccgctggaacgaccccaccatcgccttcccttggaacatcgag
cacggcccgttcctctcgccaaaggacgaaaagctgccgctgctggcggattttgtcagt
ccgttccgaatgtga

DBGET integrated database retrieval system