KEGG   Rhodopseudomonas palustris BisB18: RPC_4239Help
Entry
RPC_4239          CDS       T00336                                 

Definition
(GenBank) phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain II
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
rpc  Rhodopseudomonas palustris BisB18
Pathway
rpc00010  Glycolysis / Gluconeogenesis
rpc00030  Pentose phosphate pathway
rpc00051  Fructose and mannose metabolism
rpc00052  Galactose metabolism
rpc00230  Purine metabolism
rpc00500  Starch and sucrose metabolism
rpc00520  Amino sugar and nucleotide sugar metabolism
rpc00521  Streptomycin biosynthesis
rpc01100  Metabolic pathways
rpc01110  Biosynthesis of secondary metabolites
rpc01120  Microbial metabolism in diverse environments
rpc01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:rpc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RPC_4239
   00030 Pentose phosphate pathway
    RPC_4239
   00051 Fructose and mannose metabolism
    RPC_4239
   00052 Galactose metabolism
    RPC_4239
   00500 Starch and sucrose metabolism
    RPC_4239
   00520 Amino sugar and nucleotide sugar metabolism
    RPC_4239
  Nucleotide metabolism
   00230 Purine metabolism
    RPC_4239
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    RPC_4239
Enzymes [BR:rpc01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     RPC_4239
    5.4.2.8  phosphomannomutase
     RPC_4239
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV
Motif
Other DBs
NCBI-ProteinID: ABD89763
UniProt: Q20YM3
Position
complement(4719886..4721385)
Genome map
AA seq 499 aa AA seqDB search
MFPVPKPVLFPNTYAYESEPMVKPTGFREYDARWLFGSEINLMGVQALGMGLGTLIGELG
QRKEIITGHDFRSYSASIKYALISGLLASGCKVHDIGLCMTPMAYFAQFELDVPCVAMVT
ASHNDNGWTGVKMGANRPLTFGPEEMTRLKDIVLGAAFHNEAGGSYQFHENSPARYIADL
TKRPPLKRKLKVVVACGNGTAGAFAPQVMQAIGCEVIPLDTELDHSFPKYNPNPEDMEML
HAMRDAVLQHKADLGFGFDGDGDRCGVVDNTGEEIFADKVGVMLARDMSAITPNAEFVVD
VKSTGLFATDPVLQAQGARTEYWKTGHSYMKRRTHESKALAGFEKSGHFFFNAPLGRGYD
DGLISAIAICEMLDRASGKTMSDLKNALPKTWSSPTMSPHCADETKYGVVAAVIAHFEAA
QKHGDQVAGQPIRDLVTVNGVRVTCEDGSWGLVRASSNKPELVVVVESPVSEARMHEMFE
AVNVVLRTHPAVGAYNQTI
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgtttccggtgccgaaacccgtcttgtttccgaacacctacgcctacgaatccgagccg
atggtgaagccgaccgggtttcgcgaatacgacgcgcgctggctgttcggctccgagatc
aacctgatgggcgtgcaggcgctgggcatggggctcggcacgctgatcggcgaattgggg
cagcgcaaggagatcatcaccgggcacgatttccgcagctattcggcgtcgatcaaatac
gcgctgatctccgggctgctggcctcgggctgcaaggtgcacgacatcggtctgtgcatg
acgccgatggcgtatttcgcgcagttcgagctcgacgtgccctgcgtcgcgatggtcacc
gcctcgcacaacgacaacggctggaccggcgtcaagatgggcgccaaccgtccgctcacc
ttcgggcccgaggagatgacgcggctgaaggacatcgtgctcggcgccgcgtttcacaac
gaggccggcggctcctatcaattccacgaaaattctccggcgcgctatatcgccgatctg
accaagcggccgccgctgaagcgcaagctgaaggtggtggtggcctgcggcaacggcacc
gccggcgcgttcgcgccgcaggtgatgcaggcgatcggctgcgaggtgatcccgctcgac
accgaactcgatcacagttttccgaaatacaatcccaatccggaagacatggagatgctg
cacgcgatgcgcgacgcggtgctgcagcacaaggccgatctcggcttcggcttcgacggc
gacggcgaccgctgcggcgtcgtcgataatacgggcgaagagatttttgccgacaaggtc
ggcgtgatgctggcgcgggatatgtcggcgatcacgccgaacgcggaattcgtggtcgac
gtcaaatccaccgggctgttcgcgaccgacccggtgctgcaggcgcaaggcgccagaacc
gaatactggaagaccgggcattcctacatgaagcggcgcacccacgaatcgaaggcgctg
gccggcttcgaaaagtcgggccacttcttcttcaacgcgccgctcggccgcggctatgac
gacgggctgatctcggcgatcgcgatctgcgagatgctggatcgcgcgtccggcaagacc
atgtccgatctgaaaaacgcgctgccaaagacctggtcgtcgccgacgatgtcgccgcac
tgcgccgacgagaccaaatacggcgtggtcgccgcggtgatcgcgcatttcgaggccgcg
cagaagcacggcgaccaggtcgccggccagccgatccgcgatctcgtcaccgtcaacggc
gtccgcgtcacctgcgaagacggcagctggggcctggtgcgggcctcctccaacaagccg
gaactggtggtggtggtggaaagcccggtgtcggaagcccggatgcacgagatgttcgag
gcggtgaacgtggtgctgcgcacccaccccgcggtcggcgcctacaaccagacgatctga

DBGET integrated database retrieval system