KEGG   Rhodopseudomonas palustris BisB18: RPC_4623Help
Entry
RPC_4623          CDS       T00336                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
rpc  Rhodopseudomonas palustris BisB18
Pathway
rpc00010  Glycolysis / Gluconeogenesis
rpc00052  Galactose metabolism
rpc00500  Starch and sucrose metabolism
rpc00520  Amino sugar and nucleotide sugar metabolism
rpc00521  Streptomycin biosynthesis
rpc01100  Metabolic pathways
rpc01110  Biosynthesis of secondary metabolites
rpc01120  Microbial metabolism in diverse environments
rpc01130  Biosynthesis of antibiotics
rpc01200  Carbon metabolism
Module
rpc_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
rpc_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:rpc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RPC_4623
   00052 Galactose metabolism
    RPC_4623
   00500 Starch and sucrose metabolism
    RPC_4623
   00520 Amino sugar and nucleotide sugar metabolism
    RPC_4623
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    RPC_4623
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    RPC_4623
Enzymes [BR:rpc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     RPC_4623
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase ROK DUF4351
Motif
Other DBs
NCBI-ProteinID: ABD90145
UniProt: Q20XJ1
Position
complement(5164035..5165015)
Genome map
AA seq 326 aa AA seqDB search
MTAQLQAAGQPVLLADIGGTNARFALLRGGAIGAVMHLVVSDYPSFAEAMAAYLRKQSDL
GTIGAAHLAVAGTVENGRCVMTNSPWVIDAAELSAAFAIPAVRVINDFAAVGWSLSAIPK
ARLRQLGGGHPVPGAPLFALGPGTGLGMTTNVPLPHGRAVLPSEGGHATLAGVNPREDAV
IGVLRRKFGHVSAERALSGSGLENLYDALVSLDGLSLPPRAAPQITKAGVEGSCATCREA
VDMFCALLGSVAGNLALVLGAKGGIYVAGGIIHHMMEHLAGSQFRARFEDKGRFRSYLAA
IPVYLVLEEDVAFIGLKQFTEVVGVG
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgacggcacagctgcaagccgctggccagccggtgctgctggccgacatcggcggcacc
aatgcgcggttcgcgctgctgcgcggcggcgcgatcggtgccgtcatgcatctggtggtc
agcgattatccgagttttgccgaggccatggcggcctatctgcgcaagcagtcggatctc
ggcacgatcggtgccgcgcatctcgcggtcgccggcacggtggagaacggccgctgcgtg
atgaccaattcgccatgggtgatcgacgccgccgaactcagcgcggcgttcgcgattcct
gcggtgcgggtgatcaacgatttcgcggcggtgggatggtcgctgtcggcgatccctaag
gcgcggctgcgccagcttggcggtggccacccggtcccgggcgcgccgttgttcgcgctg
ggccccggcaccgggctaggcatgaccaccaacgtgccgctgccgcacggccgcgcggtg
ctgccgagtgaaggcggccatgccacgctcgccggcgtcaatccgcgtgaggatgcggtg
atcggcgtgctgcggcgcaagttcggtcacgtctccgccgagcgcgcgctgtccggcagc
gggctggaaaatctctacgacgcgctggtgtcgctcgatggtctttcgctgccgccgcgc
gccgcgccgcagatcaccaaggccggggtcgaaggttcgtgcgcgacctgccgcgaagcg
gtcgacatgttctgcgcgctgctcggcagcgtcgccggcaatctggcgctggtgctcggc
gccaagggcggcatctatgtcgccggcggcatcatccatcacatgatggagcacctggcg
gggtcgcaattccgcgcccggttcgaggacaagggccgatttcgcagctacctcgcggcg
atcccggtctatctggtgctggaagaggacgtcgctttcatcgggctgaagcagttcacc
gaggtggtgggggtgggctag

DBGET integrated database retrieval system