KEGG   Rhodopseudomonas palustris BisB18: RPC_4795Help
Entry
RPC_4795          CDS       T00336                                 

Definition
(GenBank) L-threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
rpc  Rhodopseudomonas palustris BisB18
Pathway
rpc00260  Glycine, serine and threonine metabolism
rpc00750  Vitamin B6 metabolism
rpc01100  Metabolic pathways
rpc01110  Biosynthesis of secondary metabolites
rpc01120  Microbial metabolism in diverse environments
rpc01230  Biosynthesis of amino acids
Module
rpc_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:rpc00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RPC_4795
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    RPC_4795
Enzymes [BR:rpc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     RPC_4795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP DUF3652
Motif
Other DBs
NCBI-ProteinID: ABD90317
UniProt: Q20X19
Position
5355318..5356796
Genome map
AA seq 492 aa AA seqDB search
MDGTSTLSRAWRKRAPLEDVLTQYISTRGEAPKLGFCDVMLTGLARDGGLYVPEIWPQLA
PDAIAGFFGRPYWEVAVEVIRPFIGGEISDEDLGRMANEAYATFRHPAVVPLRQTAPSQF
VLELFHGSTLAFKDVAMQLLSRLMDHVLAKRQQRITIVVATSGDTGGAAVDAFAGRDNVD
LIVLFPHGRISDVQRRMMTTSAASNVHAVALQGNFDDCQAIVKGLFNHHKFRDRVALSGV
NSINWARIIAQVVYYFTSAVALGAPGRGVDFTVPTGNFGDIFAGYVAKRMGLPIRKLKIA
ANVNDILARTLKTGIHEVREVHATASPSMDIQVSSNFERLLFEASGRDAALVRGLMASLQ
QSGRYVLPDRVLAAIREQFDAGRADEEETAAAIRTAWREAGDLVDPHTAVALAVADRDQT
DSSVPNIVLSTAHAAKFPDAVEAACGVRPDLPLWLEGLMTRPEQITTLKPDQATVENYVL
AVSRAAKQGVAG
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atggacggaacttccacattatcaagggcttggcgaaaacgcgcgcctttggaggacgtg
ttgacgcagtatatttcgacgcggggcgaggcccccaagctcggcttttgcgatgtcatg
ctgaccgggctcgcccgcgacggtgggctctatgtgcctgagatctggccgcaattggcg
cccgacgcgatcgcggggtttttcggccggccgtattgggaggtcgccgtcgaggtgatc
cgcccgttcatcggcggcgagatctccgacgaagatctcggccggatggccaacgaggcc
tatgccacgttccggcatcccgcggtggtgccgctgcgccagaccgcgcccagccaattc
gtgctggaattgtttcacggctcgacgctggcgttcaaggatgtcgcgatgcagctatta
tcgcggctgatggaccacgtgctggcgaagcgccaacagcgcatcaccatcgtggtcgcg
acctccggcgacaccggcggcgccgcggtcgacgccttcgccgggcgcgacaatgtcgat
ctgatcgtgctgtttccgcacggccggatctccgacgtgcaacgccggatgatgaccacg
tcggcggcgagtaacgttcacgcggtggcgctgcaaggcaatttcgacgattgccaggcg
atcgtgaaggggctgttcaaccaccacaaattccgcgatcgcgtggcgctgtccggcgtc
aattcgatcaactgggcgcggatcatcgcccaggtggtgtactacttcaccagcgcggtg
gcgctcggcgcgccggggcgcggcgtcgatttcaccgtgccgaccggcaatttcggcgac
atcttcgccggctatgtcgcaaagcggatggggctgccgatccgcaagctgaagatcgcc
gccaacgtcaacgacattttggcgcgcaccctgaagaccgggatccacgaggtccgcgag
gtccacgccaccgcgtcgccgtcgatggacatccaggtgtcgtcgaatttcgagcggctg
ctgttcgaggcctcgggccgcgacgccgccttggtgcgcgggttgatggcctcgctgcag
caatccggccgctacgtgctgccggatcgcgtgctggcggcgatccgcgaacaattcgac
gccggccgcgccgacgaagaggaaaccgcagccgcgatccgcaccgcctggcgcgaggcc
ggcgacctggtcgacccgcacaccgcggtggcgttggcggtggccgaccgcgaccaaacc
gattcgagcgttcccaacatcgtgctgtccaccgcccatgcggcgaaattccccgacgcg
gtggaagcggcctgcggcgtgcgtccggacttgccgctgtggctggagggtctgatgacg
aggcccgagcagatcaccaccctgaagcccgatcaggcgacggtggaaaactacgtgctt
gcggtcagccgcgccgcgaaacaaggagttgccggatga

DBGET integrated database retrieval system