KEGG   Rhodopseudomonas palustris BisB18: RPC_4795Help
Entry
RPC_4795          CDS       T00336                                 

Definition
(GenBank) L-threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
rpc  Rhodopseudomonas palustris BisB18
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:rpc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RPC_4795
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RPC_4795
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    RPC_4795
Enzymes [BR:rpc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     RPC_4795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
5355318..5356796
Genome map
AA seq 492 aa AA seqDB search
MDGTSTLSRAWRKRAPLEDVLTQYISTRGEAPKLGFCDVMLTGLARDGGLYVPEIWPQLA
PDAIAGFFGRPYWEVAVEVIRPFIGGEISDEDLGRMANEAYATFRHPAVVPLRQTAPSQF
VLELFHGSTLAFKDVAMQLLSRLMDHVLAKRQQRITIVVATSGDTGGAAVDAFAGRDNVD
LIVLFPHGRISDVQRRMMTTSAASNVHAVALQGNFDDCQAIVKGLFNHHKFRDRVALSGV
NSINWARIIAQVVYYFTSAVALGAPGRGVDFTVPTGNFGDIFAGYVAKRMGLPIRKLKIA
ANVNDILARTLKTGIHEVREVHATASPSMDIQVSSNFERLLFEASGRDAALVRGLMASLQ
QSGRYVLPDRVLAAIREQFDAGRADEEETAAAIRTAWREAGDLVDPHTAVALAVADRDQT
DSSVPNIVLSTAHAAKFPDAVEAACGVRPDLPLWLEGLMTRPEQITTLKPDQATVENYVL
AVSRAAKQGVAG
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atggacggaacttccacattatcaagggcttggcgaaaacgcgcgcctttggaggacgtg
ttgacgcagtatatttcgacgcggggcgaggcccccaagctcggcttttgcgatgtcatg
ctgaccgggctcgcccgcgacggtgggctctatgtgcctgagatctggccgcaattggcg
cccgacgcgatcgcggggtttttcggccggccgtattgggaggtcgccgtcgaggtgatc
cgcccgttcatcggcggcgagatctccgacgaagatctcggccggatggccaacgaggcc
tatgccacgttccggcatcccgcggtggtgccgctgcgccagaccgcgcccagccaattc
gtgctggaattgtttcacggctcgacgctggcgttcaaggatgtcgcgatgcagctatta
tcgcggctgatggaccacgtgctggcgaagcgccaacagcgcatcaccatcgtggtcgcg
acctccggcgacaccggcggcgccgcggtcgacgccttcgccgggcgcgacaatgtcgat
ctgatcgtgctgtttccgcacggccggatctccgacgtgcaacgccggatgatgaccacg
tcggcggcgagtaacgttcacgcggtggcgctgcaaggcaatttcgacgattgccaggcg
atcgtgaaggggctgttcaaccaccacaaattccgcgatcgcgtggcgctgtccggcgtc
aattcgatcaactgggcgcggatcatcgcccaggtggtgtactacttcaccagcgcggtg
gcgctcggcgcgccggggcgcggcgtcgatttcaccgtgccgaccggcaatttcggcgac
atcttcgccggctatgtcgcaaagcggatggggctgccgatccgcaagctgaagatcgcc
gccaacgtcaacgacattttggcgcgcaccctgaagaccgggatccacgaggtccgcgag
gtccacgccaccgcgtcgccgtcgatggacatccaggtgtcgtcgaatttcgagcggctg
ctgttcgaggcctcgggccgcgacgccgccttggtgcgcgggttgatggcctcgctgcag
caatccggccgctacgtgctgccggatcgcgtgctggcggcgatccgcgaacaattcgac
gccggccgcgccgacgaagaggaaaccgcagccgcgatccgcaccgcctggcgcgaggcc
ggcgacctggtcgacccgcacaccgcggtggcgttggcggtggccgaccgcgaccaaacc
gattcgagcgttcccaacatcgtgctgtccaccgcccatgcggcgaaattccccgacgcg
gtggaagcggcctgcggcgtgcgtccggacttgccgctgtggctggagggtctgatgacg
aggcccgagcagatcaccaccctgaagcccgatcaggcgacggtggaaaactacgtgctt
gcggtcagccgcgccgcgaaacaaggagttgccggatga

DBGET integrated database retrieval system