KEGG   Rhodopseudomonas palustris BisB5: RPD_0077Help
Entry
RPD_0077          CDS       T00345                                 

Definition
(GenBank) succinyldiaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
rpd  Rhodopseudomonas palustris BisB5
Pathway
rpd00300  Lysine biosynthesis
rpd01100  Metabolic pathways
rpd01120  Microbial metabolism in diverse environments
rpd01230  Biosynthesis of amino acids
Module
rpd_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:rpd00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    RPD_0077
Enzymes [BR:rpd01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     RPD_0077
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: ABE37317
JGI: RPD0077
UniProt: Q13F22
Position
92115..93281
Genome map
AA seq 388 aa AA seqDB search
MTSSRDALSIAQALLRCPSVTPADAGALGVLETLLKDAGFTAHRVTFSEPGAADIDNLYA
RIGDGAPHLCFAGHTDVVPPGDADAWSHGAFSGDVEGGLLYGRGAVDMKGGIACAVAAVL
DHLAAHGGRPKGSISFLITGDEEDVAVNGTVKLLQWAADRGETFDHCIVGEPSNVEAIGD
TIKIGRRGSQSGMLIVDGLQGHVAYPHRASNPIPDIAALITALNDEPLDQGSAQFQPSNL
EFTSVDVGNPATNVIPAQARAKFNIRFNDHHTQDSLKALIEQRLAAACGNRIRARIEWLP
SNADVFVTKPGNFTDLVTASIADVTGRTPDLNTGGGTSDARFIAKYCPVVEFGLVGQTMH
QIDERTPVADLDQLTAIYRGVLERYFKS
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgacatcatcgcgtgacgccctctccatcgctcaagccctgctgcgctgtccgtctgtc
acgccggccgacgccggcgcgctcggtgtgctggagacgctgctgaaggacgccggcttc
accgcgcatcgcgtgaccttcagcgagcccggcgccgccgacatcgacaatctctacgca
cggatcggcgatggcgcgccgcatctgtgctttgccggccataccgacgtggtgccgccg
ggcgacgcagacgcgtggagccacggcgcgttttccggcgatgtcgaaggcggcctgctg
tacggccgcggcgcggtcgacatgaaaggcggcatcgcctgcgcggtcgccgccgtgctc
gatcatctcgccgcccatggcggccggccaaagggatcgatctcgttcctgatcaccggc
gacgaggaagacgtcgccgtcaacggcaccgtcaagctgctgcaatgggcggcggatcgc
ggcgagacattcgatcattgcatcgtcggcgagccgagcaatgtcgaggcgatcggcgac
accatcaagataggccggcgcggctcgcagtccggcatgctgatcgtcgacggactgcag
ggccacgtcgcctatccgcatcgggcctcgaacccgatcccggatatcgcggcgctgatc
accgcgctgaacgacgagccgctggatcagggctcggcgcagtttcagccgtccaatctc
gaattcacctcggtcgatgtcggaaatccggcgactaatgtgatcccggcgcaggcgcgg
gccaaattcaacatccgcttcaacgatcaccacacccaggattcgttgaaggcgctgatc
gagcagcggctggcggcggcgtgcggcaaccgcatccgcgcgcggatcgagtggttgccg
tcgaacgccgacgtgttcgtcaccaagcccggcaatttcaccgatctggtcaccgcatcg
atcgccgacgtgaccggccgcacgcccgatctcaacaccggcggcggcacctcggacgcg
cggttcatcgccaaatactgcccggtggtggagttcggcctggtcggccagaccatgcac
cagatcgacgagcgcacgccggtcgcggatctcgaccagctcaccgcgatctatcgcggc
gtgctggagcgatatttcaagtcataa

DBGET integrated database retrieval system