KEGG   Rhodopseudomonas palustris BisB5: RPD_0197Help
Entry
RPD_0197          CDS       T00345                                 

Definition
(GenBank) tryptophan synthase, beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
rpd  Rhodopseudomonas palustris BisB5
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rpd00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RPD_0197
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RPD_0197
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    RPD_0197
Enzymes [BR:rpd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     RPD_0197
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
220569..221783
Genome map
AA seq 404 aa AA seqDB search
MNQILPNSFRSGPDERGHFGIFGGRFVAETLMPLILELEKAYAEAKDDPAFRTEMDGYLK
HYVGRPSPLYFAERLTEHFGGAKIYFKREDLNHTGAHKVNNVLGQIMLARRMGKQRIIAE
TGAGMHGVATATMCAKFGLQCVVYMGAVDVERQQPNVLRMKALGAEVRPVTSGANTLKDA
MNEALRDWVTNVHDTFYCIGTVAGPHPYPMMVRDFQEVIGQEVREQILETEGRLPDSLIA
CIGGGSNAMGLFHPFLDDAGVVIYGVEAAGHGLSKLHAASIAGGKPGVLHGNRTYLLMDD
DGQIQEAHSISAGLDYPGIGPEHAWLHDVGRVNFLSATDAEALDAFKLCCRLEGIIPALE
PAHALAKVADLAPILPKDHLMVLNMSGRGDKDLASVAEHLGGKF
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaatcagatcctgccgaattcgtttcgatccggtcccgacgagcgcgggcatttcggc
attttcggcggccgcttcgtcgccgagacgttgatgccgctgatcctggagctggaaaag
gcctacgctgaggcaaaagacgatccggcgtttcgcaccgagatggacggctatctcaag
cattatgtcggccggccgtcgccgctgtatttcgccgagcggctgaccgagcatttcggc
ggcgccaagatctacttcaagcgcgaggatctcaatcacaccggcgcccacaaggtgaac
aacgtgctcggccagatcatgctggccaggcggatgggcaagcagcggatcatcgccgag
accggcgccggcatgcacggcgtcgccaccgccacgatgtgcgccaagttcggcctgcaa
tgcgtggtctatatgggcgcggtcgacgtcgagcggcagcagcccaatgtgctgcggatg
aaggcgctgggcgccgaagtccgcccggtgacctccggcgccaacacgctgaaggacgcg
atgaacgaggcgctgcgggactgggtcaccaacgttcacgacaccttctactgcatcggc
accgtcgcgggcccgcacccctatccgatgatggtgcgcgacttccaggaggtgatcggc
caggaggtgcgcgagcagattctggagaccgaaggccggctgccggattcgctgatcgcc
tgcatcggcggcggctccaacgcgatgggcctgtttcaccccttcctcgacgacgccggc
gtcgtgatctacggcgtcgaagccgcgggccatggcctcagcaagctgcatgcggcgtcg
atcgccggcggcaagcccggcgtgctgcacggcaatcgcacctatctgctgatggacgat
gacggccagatccaggaagcgcattcgatttccgccggcctcgactatcccggcatcggc
cccgagcacgcctggctgcacgatgtcggccgcgtcaacttcctgtcggccaccgacgcc
gaggcgctcgacgccttcaagctgtgctgccgtctcgagggcatcattccggcgctggag
ccggcgcatgcgctggccaaggtcgccgatctcgcgccgatcctgccgaaggatcacttg
atggtgctcaacatgtccggccgcggcgacaaggatctcgcttctgtggccgagcatctc
gggggcaagttctga

DBGET integrated database retrieval system