KEGG   Rhodopseudomonas palustris BisB5: RPD_0198Help
Entry
RPD_0198          CDS       T00345                                 

Definition
(GenBank) tryptophan synthase, alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
rpd  Rhodopseudomonas palustris BisB5
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rpd00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RPD_0198
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RPD_0198
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    RPD_0198
Enzymes [BR:rpd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     RPD_0198
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
221783..222619
Genome map
AA seq 278 aa AA seqDB search
MTTRIDTRFAELKKQGRSAFVTFVMAGDPDLATSLQVLKALPAAGADIIEIGMPFTDPMA
DGPAIQAAGLRALHSGATLSHTLGLVRDFRKDDDTTPMVLMGYYNPIYIYGVDAFLADAK
AAGVDGLIIVDLPPEEDSELCLPAMKAGLNFIRLATPTTDEKRLPAVLANTSGFVYYVSI
TGITGSASADSAAVGDAVARIKRHTDLPVCVGFGIRTPEAARAIAAEADGAVVGSALIDA
LQKSLDADNRATKATVGAVADLVASLAAGVRGAKQAAE
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgcgtatcgatacccgctttgccgagttgaagaagcagggccgctccgccttc
gtcactttcgtgatggccggagatcccgatctcgccacctcgctgcaggtcctgaaggcg
ctgcccgccgccggcgcggatatcattgagatcggaatgccgttcaccgacccgatggcc
gacggaccggcgatccaggccgcggggctgcgggcgctccattccggcgccacgctgagc
cacacgctggggctggtgcgcgacttccgcaaggacgacgacaccacgccgatggtgctg
atgggttactacaatccgatctatatctacggcgtcgatgcgtttctcgccgacgccaag
gcggccggcgtcgacgggctgatcatcgtcgacctgccgccggaggaggattccgagctg
tgcctgccggcgatgaaagccggactgaatttcatccggctggcgacgccgaccaccgac
gaaaagcggttgccggcagtgctcgccaacacctcgggcttcgtctattacgtgtcgatc
accggcatcaccggctcggcttcggcggattcggccgcagtcggcgacgcggtggcccgg
atcaagcgccacaccgacctgccggtctgcgtcggcttcggcattcgcaccccggaagcg
gcgcgggcgatcgccgcggaggccgacggtgcggtcgtcggatcggcgctgatcgacgcg
ctgcaaaagagcctcgacgccgacaaccgcgccaccaaggcgaccgtcggtgcggtagcg
gacctggtcgcctcgctggcggcgggcgttcgcggcgccaaacaggctgcggaatag

DBGET integrated database retrieval system