KEGG   Rhodopseudomonas palustris BisB5: RPD_0212Help
Entry
RPD_0212          CDS       T00345                                 

Definition
formamidopyrimidine-DNA glycosylase (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
rpd  Rhodopseudomonas palustris BisB5
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:rpd03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
242693..243574
Genome map
AA seq 293 aa AA seqDB search
MPELPEVETVRLGLTPAMEGFRIARAVTNRDDLRFPLQKDFVARLTGQIVTGLGRRAKYL
LADLASGDVLLMHLGMSGSFRVVAADGAHTPGEFHHPRSEDRTHDHVVFDMSSGARVIFN
DPRRFGFMKIFPRAAIDDEPHLKGLGPEPLGNAFDAVMLARACAGKQTSLKAALLDQRVV
AGLGNIYVCEALWRAHLSPKRKAATLANRKNEPTDHALRLTDAIRAVLGDAIKAGGSSLR
DHRQTSGELGYFQHSFAAYDREGERCRTDGCGGAVKRFVQNGRSTFWCSGCQK
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaactgcccgaagtcgaaaccgtccgcctcggcctgacgcccgcgatggaaggg
ttccggatcgcgcgggcggtgacgaatcgggacgatctgcggtttccgctgcagaaggat
tttgtcgcgcggctgaccggacagatcgtcacggggctggggcggcgcgccaaatatctg
ctggccgacctcgcttccggcgacgtgctgctgatgcatctcgggatgtccggctcgttc
cgggtggtcgccgccgacggcgcgcacacgccgggcgaatttcaccatccgcgcagcgag
gaccgcacccatgatcatgtggtgttcgacatgtcgtccggcgcgcgggtgatcttcaac
gacccgcggcggttcggcttcatgaagatctttccgcgcgccgccatcgacgacgagccg
catctcaagggactcggccccgagccgctcggcaacgccttcgacgccgtgatgctggcg
cgcgcctgcgccggcaagcagaccagcctgaaggcggcgctgctggaccagcgcgtcgtc
gccgggctcggcaacatctatgtctgcgaggcgctgtggcgcgcgcatctgtcccccaag
cgcaaggcggcgacgctcgccaaccgcaagaacgagccgaccgatcacgcgctgcggctg
accgacgcgatccgcgccgtgctcggcgacgccatcaaggccggcggctcgtcgctgcgc
gaccaccgccagacctccggcgaactcggttacttccagcattccttcgccgcctacgac
cgcgaaggcgaacgctgccgcaccgacggctgcggcggcgccgtgaagcgcttcgtgcag
aacggccgctcgacgttctggtgttcggggtgtcagaagtag

DBGET integrated database retrieval system