KEGG   Rhodopseudomonas palustris BisB5: RPD_0347Help
Entry
RPD_0347          CDS       T00345                                 

Definition
PfkB
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
rpd  Rhodopseudomonas palustris BisB5
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rpd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RPD_0347
   01230 Biosynthesis of amino acids
    RPD_0347
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RPD_0347
   00030 Pentose phosphate pathway
    RPD_0347
   00051 Fructose and mannose metabolism
    RPD_0347
   00052 Galactose metabolism
    RPD_0347
  Energy metabolism
   00680 Methane metabolism
    RPD_0347
Enzymes [BR:rpd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     RPD_0347
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(409676..410614)
Genome map
AA seq 312 aa AA seqDB search
MVELVTLTPNPAIDLSTSVERMVPSRKLRCAAQQRDPGGGGINVARVVKRFGGDVEAIFP
AGGFTGQLLRSLLDREHIPSRVVDAVAETREDFSVTEAATGQQFRFVLPGLPLAEGEWRG
LLELLAGTTPAPKIVVGSGSLPPGVPHDFYAQAAAVAKRIGAQFFLDTSGASLVAALDQG
VTLIKPNLREMQELAGRPLDGEKDWIEAARQPIAAGKVEIVALSLGHLGALLVTKDLALR
SPALPVNQVSTVGAGDSFLGAIAFSLAKGRPIEDAFRLALASGSASLTMQGTELCRPADV
ERLCAQVVIEAL
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atggtcgaactcgtgaccctgacgccgaatccggcgattgatctgtcgacatcggtcgag
cgcatggtgccgagccgcaagctgcgctgcgcggcgcagcagcgcgatccaggcggcggc
ggcatcaatgtcgcgcgggtggtgaagcggttcggcggcgacgtcgaggcgattttcccg
gccggcggcttcaccggccagttgctgcgatcgctgctcgaccgcgagcacattcccagt
cgggtggtcgatgcggtggccgagacccgcgaggatttttccgtcaccgaggcggcgacc
ggccagcaattccgcttcgtgctgcccggcctgccgctcgccgagggcgaatggcgcggc
ctgctggagcttctcgccggcaccactccggcgccgaagatcgtggtcggcagcggcagc
ctgccgcccggcgtgccgcatgatttctacgcccaggccgccgcggtggcgaagcggatc
ggcgcgcaattcttcctcgacacctccggcgcctcgctggtggccgcgctcgaccaaggc
gtcacgctgatcaagccgaatctgcgcgagatgcaggaactggccggacgcccgctcgat
ggcgagaaggattggatcgaagccgcgcggcaaccgatcgcggccggcaaggtcgaaatc
gtcgcgctgtcgctcggccatctcggcgcgctgctggtgaccaaagacttggcgctgcgc
tcgccggcgctgccggtcaatcaggtctccaccgtcggcgccggcgacagttttctgggc
gcgattgccttcagcctggcgaagggccggccgatcgaggacgccttccgcctcgcactc
gcctcgggctccgcgtcgctgacgatgcagggcaccgaattgtgccggccggcggatgtc
gagcggctgtgtgcgcaggtcgtgatcgaggcgctgtag

DBGET integrated database retrieval system