KEGG   Rhodopseudomonas palustris BisB5: RPD_0347Help
Entry
RPD_0347          CDS       T00345                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K16370  6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
rpd  Rhodopseudomonas palustris BisB5
Pathway
rpd00010  Glycolysis / Gluconeogenesis
rpd00030  Pentose phosphate pathway
rpd00051  Fructose and mannose metabolism
rpd00052  Galactose metabolism
rpd00680  Methane metabolism
rpd01100  Metabolic pathways
rpd01110  Biosynthesis of secondary metabolites
rpd01120  Microbial metabolism in diverse environments
rpd01130  Biosynthesis of antibiotics
rpd01200  Carbon metabolism
rpd01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rpd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RPD_0347
   00030 Pentose phosphate pathway
    RPD_0347
   00051 Fructose and mannose metabolism
    RPD_0347
   00052 Galactose metabolism
    RPD_0347
  Energy metabolism
   00680 Methane metabolism
    RPD_0347
Enzymes [BR:rpd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     RPD_0347
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin
Motif
Other DBs
NCBI-ProteinID: ABE37585
JGI: RPD0347
UniProt: Q13EA4
Position
complement(409676..410614)
Genome map
AA seq 312 aa AA seqDB search
MVELVTLTPNPAIDLSTSVERMVPSRKLRCAAQQRDPGGGGINVARVVKRFGGDVEAIFP
AGGFTGQLLRSLLDREHIPSRVVDAVAETREDFSVTEAATGQQFRFVLPGLPLAEGEWRG
LLELLAGTTPAPKIVVGSGSLPPGVPHDFYAQAAAVAKRIGAQFFLDTSGASLVAALDQG
VTLIKPNLREMQELAGRPLDGEKDWIEAARQPIAAGKVEIVALSLGHLGALLVTKDLALR
SPALPVNQVSTVGAGDSFLGAIAFSLAKGRPIEDAFRLALASGSASLTMQGTELCRPADV
ERLCAQVVIEAL
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atggtcgaactcgtgaccctgacgccgaatccggcgattgatctgtcgacatcggtcgag
cgcatggtgccgagccgcaagctgcgctgcgcggcgcagcagcgcgatccaggcggcggc
ggcatcaatgtcgcgcgggtggtgaagcggttcggcggcgacgtcgaggcgattttcccg
gccggcggcttcaccggccagttgctgcgatcgctgctcgaccgcgagcacattcccagt
cgggtggtcgatgcggtggccgagacccgcgaggatttttccgtcaccgaggcggcgacc
ggccagcaattccgcttcgtgctgcccggcctgccgctcgccgagggcgaatggcgcggc
ctgctggagcttctcgccggcaccactccggcgccgaagatcgtggtcggcagcggcagc
ctgccgcccggcgtgccgcatgatttctacgcccaggccgccgcggtggcgaagcggatc
ggcgcgcaattcttcctcgacacctccggcgcctcgctggtggccgcgctcgaccaaggc
gtcacgctgatcaagccgaatctgcgcgagatgcaggaactggccggacgcccgctcgat
ggcgagaaggattggatcgaagccgcgcggcaaccgatcgcggccggcaaggtcgaaatc
gtcgcgctgtcgctcggccatctcggcgcgctgctggtgaccaaagacttggcgctgcgc
tcgccggcgctgccggtcaatcaggtctccaccgtcggcgccggcgacagttttctgggc
gcgattgccttcagcctggcgaagggccggccgatcgaggacgccttccgcctcgcactc
gcctcgggctccgcgtcgctgacgatgcagggcaccgaattgtgccggccggcggatgtc
gagcggctgtgtgcgcaggtcgtgatcgaggcgctgtag

DBGET integrated database retrieval system