KEGG   Rhodopseudomonas palustris BisB5: RPD_0480Help
Entry
RPD_0480          CDS       T00345                                 

Definition
succinate dehydrogenase, cytochrome b subunit
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
rpd  Rhodopseudomonas palustris BisB5
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:rpd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RPD_0480
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RPD_0480
   00650 Butanoate metabolism
    RPD_0480
  Energy metabolism
   00190 Oxidative phosphorylation
    RPD_0480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(554926..555348)
Genome map
AA seq 140 aa AA seqDB search
MSGEESHGATRRQAASMRTPMGKVRKLGPAGSGTSDFWQQRITGVAMTLLTLPVVVVVMM
LLGRNQAGAAQILGSPLISLTMILFIIASAIHMKIGMQVVIEDYIQNEKLKLVTVMANNF
FTIAVALAAIFAIFKLASGV
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atgagcggcgaggaatcccacggcgccacccggcgccaggccgcgtcgatgcgcacgccg
atgggcaaggtgcgcaagctcggccctgccggatccggcacctctgatttctggcagcag
cgcatcaccggcgtggcgatgaccctgctgaccctgcccgtggtggtggtggtcatgatg
ctgctcggccgcaaccaggccggcgcggcgcagatcctcggctcgccgctgatctcgctg
accatgatcctgttcatcatcgccagcgcgatccacatgaagatcggcatgcaggtggtg
atcgaggactacatccagaacgagaagctgaagctcgttacggtgatggccaacaatttc
ttcacgatcgccgtggcgctggccgcgatcttcgcgatcttcaaactcgcatccggagtg
taa

DBGET integrated database retrieval system