KEGG   Rhodopseudomonas palustris BisB5: RPD_0480Help
Entry
RPD_0480          CDS       T00345                                 

Definition
(GenBank) succinate dehydrogenase subunit D
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
rpd  Rhodopseudomonas palustris BisB5
Pathway
rpd00020  Citrate cycle (TCA cycle)
rpd00190  Oxidative phosphorylation
rpd00650  Butanoate metabolism
rpd01100  Metabolic pathways
rpd01110  Biosynthesis of secondary metabolites
rpd01120  Microbial metabolism in diverse environments
rpd01130  Biosynthesis of antibiotics
rpd01200  Carbon metabolism
Module
rpd_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rpd_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
rpd_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:rpd00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RPD_0480
   00650 Butanoate metabolism
    RPD_0480
  Energy metabolism
   00190 Oxidative phosphorylation
    RPD_0480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: ABE37718
JGI: RPD0480
UniProt: Q13DX1
Position
complement(554926..555348)
Genome map
AA seq 140 aa AA seqDB search
MSGEESHGATRRQAASMRTPMGKVRKLGPAGSGTSDFWQQRITGVAMTLLTLPVVVVVMM
LLGRNQAGAAQILGSPLISLTMILFIIASAIHMKIGMQVVIEDYIQNEKLKLVTVMANNF
FTIAVALAAIFAIFKLASGV
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atgagcggcgaggaatcccacggcgccacccggcgccaggccgcgtcgatgcgcacgccg
atgggcaaggtgcgcaagctcggccctgccggatccggcacctctgatttctggcagcag
cgcatcaccggcgtggcgatgaccctgctgaccctgcccgtggtggtggtggtcatgatg
ctgctcggccgcaaccaggccggcgcggcgcagatcctcggctcgccgctgatctcgctg
accatgatcctgttcatcatcgccagcgcgatccacatgaagatcggcatgcaggtggtg
atcgaggactacatccagaacgagaagctgaagctcgttacggtgatggccaacaatttc
ttcacgatcgccgtggcgctggccgcgatcttcgcgatcttcaaactcgcatccggagtg
taa

DBGET integrated database retrieval system