KEGG   Rhodopseudomonas palustris BisB5: RPD_0532Help
Entry
RPD_0532          CDS       T00345                                 

Definition
G-D-S-L lipolytic protein
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
rpd  Rhodopseudomonas palustris BisB5
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:rpd00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    RPD_0532
Enzymes [BR:rpd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     RPD_0532
   3.1.2  Thioester hydrolases
    3.1.2.-  
     RPD_0532
Lipid biosynthesis proteins [BR:rpd01004]
 Fatty acid synthase
  Component type
   RPD_0532
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
604899..605534
Genome map
AA seq 211 aa AA seqDB search
MVIAALAMTAMPIQRAAAQAAAKPLKVVVLGDSLSAGYGLPAEAAFPAKLQKALQAKGIA
TDMINAGVSGDTASGGLQRLDWSVPPDADAVIVELGANDALRGTDPKVPQQALDEIVKRL
KARNIAVLLCGMLAPPNYGPDYAKQFNAIYPDLAGKHGVPLYRFFLDGVAAVANLNQPDG
IHPTAAGIDVVVANILPTVEAFLRSVGAQKG
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atggttatcgcggcgttggcgatgacggcgatgccgatccagcgcgccgcggcgcaggcg
gctgcgaagccgctgaaggtcgtggtgctgggcgattcgctgtcggctggttatggatta
ccggccgaggccgcgtttccggcgaagctgcagaaagccctgcaggccaaggggatcgcg
accgacatgatcaatgccggggtgtcgggcgacaccgcgagcggcgggctgcagcggctc
gactggtcggtgccgccggacgccgatgcggtgatcgtcgaactcggcgccaatgatgcg
ctgcgcggcaccgaccccaaggtcccccaacaggcgctggacgagatcgtcaagcgcctg
aaggcgcgcaacatcgcggtgctgttgtgcgggatgctggcgccgccgaattacgggccg
gactacgccaagcagttcaacgcgatttatcccgatctcgccggcaaacacggcgtgccg
ctgtatcggtttttcctcgatggcgtcgccgcagtcgcgaacctcaatcagcccgacggc
attcatccgaccgccgccggcatcgacgtcgtggtcgcgaacattctgcccacggtcgag
gcatttctgcgatcggtcggtgcgcagaagggctga

DBGET integrated database retrieval system