KEGG   Rhodopseudomonas palustris BisB5: RPD_0545Help
Entry
RPD_0545          CDS       T00345                                 

Definition
dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
rpd  Rhodopseudomonas palustris BisB5
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rpd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RPD_0545
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RPD_0545
  Amino acid metabolism
   00310 Lysine degradation
    RPD_0545
Enzymes [BR:rpd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     RPD_0545
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
618849..620150
Genome map
AA seq 433 aa AA seqDB search
MTDIRVPTLGESVTEATIGRWFKKQGDAVAVDEPLVELETDKVTIEVPAPSAGTLGEIIA
KDGETVAVGALLGQISEGGGAAKPAAKDTPKATAAVAPETTTGRPDLKTDTTKPINAGPE
EVRPKPELKTPPSDAPQAPSVRRLSSESGVDAATVPGSGKDGRVTKGDMLAAIEKAASAP
TPVNQPAAAMQVRAPSPADDAAREERVKMTRLRQTIARRLKEVQNTAAMLTTFNEVDMTN
VMALRAQYKDVFEKKHGAKLGFMGFFTKACVQALKDIPAANAEIDGTDLIYKNYYHVGVA
VGTDKGLVVPVVRDCDEKSIADIEKSIADFGKRARDGQLKIEEMQGGTFTITNGGIYGSL
MSTPILNAPQSAILGMHKIQERPVAIGGKVEVRPMMYLALSYDHRVIDGKEAVTFLVRVK
ESLEDPARLVLDL
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgactgacattcgcgttccgacgctcggcgaatcggtgaccgaggcgacgatcggtcgc
tggttcaagaagcagggcgatgccgtcgcggtcgacgagccgctggtcgaactcgagacc
gacaaggtcaccatcgaagtgccggcgccatcggccggcacgctcggcgaaatcatcgcc
aaggacggcgagaccgtcgccgtcggcgcgctgctgggccagatctcggaaggcggcggc
gccgccaagccggccgccaaggacaccccgaaggcgaccgcggcagtcgcgccggaaacg
accaccggccgtccggatctcaagaccgacaccaccaagccgatcaatgccggccccgaa
gaggtccggccgaagcccgagctgaagaccccgccgtccgacgcgccgcaggcgccgtcg
gtgcgccggctgtcgagcgaaagcggcgtcgacgccgcgaccgtgccgggctccggcaag
gacggccgcgtcaccaagggcgacatgctggcggcgatcgagaaggcggcgtcggcgccg
accccggtcaaccagcccgccgcggcgatgcaggtccgcgccccgtcgccggccgacgac
gccgcgcgcgaagagcgggtcaagatgacccggctgcgccagaccatcgcgcgacggctc
aaggaagttcagaacaccgccgcgatgctgacgaccttcaacgaggtcgacatgaccaac
gtcatggcgctgcgggcgcagtacaaggacgtgttcgagaagaagcacggcgccaagctc
ggcttcatgggcttcttcaccaaggcctgcgtgcaggcgctgaaggacatcccggccgcc
aatgccgagatcgacggcaccgatctgatctacaagaactactaccatgtcggcgtcgcg
gtcggcaccgacaagggtctggtggtgccggtggtgcgcgactgcgatgagaagtcgatc
gccgacatcgaaaagagcatcgccgatttcggcaagcgcgcccgcgacggccagctcaag
atcgaggagatgcagggcggcaccttcaccatcaccaatggcggcatctacggttcgctg
atgtcgacgccgatcctcaacgcgccgcaatcggccattctcggaatgcacaagatccag
gagcggccggtggcgatcggcggcaaggtcgaagtgcggccgatgatgtatctggcgctc
agctacgatcaccgcgtgatcgacggcaaggaagcggtcaccttcctggtccgcgtcaag
gaaagcctggaagacccggcgcggctggtgctggatctgtaa

DBGET integrated database retrieval system