KEGG   Rhodopseudomonas palustris BisB5: RPD_0822Help
Entry
RPD_0822          CDS       T00345                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
rpd  Rhodopseudomonas palustris BisB5
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:rpd00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RPD_0822
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RPD_0822
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    RPD_0822
Enzymes [BR:rpd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     RPD_0822
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
925454..926872
Genome map
AA seq 472 aa AA seqDB search
MTTYVSTRGEAPRLGFCDVMLTGLARDGGLYLPEVWPQLSPETIAGLFGRPYWEVAVEVI
RPFVAGEISDAELGRMANEAYATFRHPAVVPLRQTGPSQFVLELFHGPTLAFKDVAMQLL
SRLMDHVLEKRKQRTTIVVATSGDTGGAAVDAFANLNNVDLVVLFPHGRISDVQRMMMTT
SAAPNVHALAIEGHFDDCQAIVKGLFNHHAFRDKVALSGVNSINWARIVAQVVYYFTSAV
ALGAPNRQVDFTVPTGNFGDIFAGYVAKKMGLPVRRLKIAANVNDILARTLKTGIYEVRE
VHATTSPSMDIQVSSNFERLLFEATGRDAAQVRALMGSLAQSGRFVLPDAVLAAIREEFD
AGRADETETEAAIRAAWREAGDLVDPHTAVALAVADRDTTDPTVPNIVLSTAHAAKFPDA
VEAACGMRPELPAWLDGLMSGTEQMQVMPRDQAAIERHVLSISRAAKQGAVG
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
ttgacgacctacgtttcgacccggggtgaagccccgcgcctcggcttttgcgacgtgatg
ctgaccgggctcgcccgtgacggcgggctgtatctgcccgaagtctggccacagctctct
cccgagaccatcgccggcctgttcggccggccttactgggaggtcgccgtcgaggtgatc
cggccgttcgtggccggcgagatttccgacgccgagctcggccggatggccaacgaggcc
tatgcgaccttccgtcatcccgcggtggtgccgctgcgccagaccggcccgagccagttc
gtgctcgagctgttccacggcccgacgctggcgttcaaggacgtcgcgatgcagttgctg
tcgcggctgatggatcacgtgctggagaagcgcaagcagcgtaccaccatcgtggtcgca
acctccggcgacaccggcggggccgcggtcgacgctttcgccaatctgaacaatgtcgat
ctcgtggtgctgtttccgcatggccggatctccgacgtgcagcggatgatgatgacgacc
tcggcggcgccgaacgtccatgcgctggcgatcgaggggcatttcgacgattgccaggcg
atcgtgaagggcctgttcaatcatcacgcctttcgcgacaaggtcgcgctgtccggcgtc
aattcgatcaactgggcgcggatcgtcgcccaggtggtgtattacttcaccagcgcggtg
gcgctcggggcgccgaaccggcaggtcgacttcaccgtgccgaccggcaatttcggcgac
atcttcgccggctacgtcgccaagaagatgggcctgccggtgcggcggctgaagatcgcc
gccaacgtcaacgacatcctggcgcggacgctgaagaccggcatctacgaggtgcgcgag
gtgcacgccaccacctcgccgtcgatggacatccaggtgtcctcgaatttcgagcggctg
ctgttcgaggcgaccggccgcgacgccgcgcaggtgcgggcgctgatgggctcgctcgcc
cagtccggccgtttcgtgctgccggatgcggtgctggcggctatccgcgaggaattcgac
gccggccgtgccgacgagaccgagaccgaggcggcgatccgcgccgcctggcgcgaggcc
ggcgatctggtcgatccgcacaccgccgtcgccctggcggtcgctgatcgcgacaccacg
gacccaaccgtccccaacatcgttctgtccaccgcgcacgcggccaaattccctgacgcg
gtcgaggccgcctgtggaatgcggccggagttgccggcctggctcgacggtttgatgagc
gggacggagcagatgcaagtgatgccccgcgatcaggcggcgatcgaacgccacgtgctg
tccatcagccgtgcggccaaacaaggagctgtcggatga

DBGET integrated database retrieval system