KEGG   Rhodopseudomonas palustris BisB5: RPD_0822Help
Entry
RPD_0822          CDS       T00345                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
rpd  Rhodopseudomonas palustris BisB5
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:rpd00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RPD_0822
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RPD_0822
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    RPD_0822
Enzymes [BR:rpd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     RPD_0822
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
925454..926872
Genome map
AA seq 472 aa AA seqDB search
MTTYVSTRGEAPRLGFCDVMLTGLARDGGLYLPEVWPQLSPETIAGLFGRPYWEVAVEVI
RPFVAGEISDAELGRMANEAYATFRHPAVVPLRQTGPSQFVLELFHGPTLAFKDVAMQLL
SRLMDHVLEKRKQRTTIVVATSGDTGGAAVDAFANLNNVDLVVLFPHGRISDVQRMMMTT
SAAPNVHALAIEGHFDDCQAIVKGLFNHHAFRDKVALSGVNSINWARIVAQVVYYFTSAV
ALGAPNRQVDFTVPTGNFGDIFAGYVAKKMGLPVRRLKIAANVNDILARTLKTGIYEVRE
VHATTSPSMDIQVSSNFERLLFEATGRDAAQVRALMGSLAQSGRFVLPDAVLAAIREEFD
AGRADETETEAAIRAAWREAGDLVDPHTAVALAVADRDTTDPTVPNIVLSTAHAAKFPDA
VEAACGMRPELPAWLDGLMSGTEQMQVMPRDQAAIERHVLSISRAAKQGAVG
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
ttgacgacctacgtttcgacccggggtgaagccccgcgcctcggcttttgcgacgtgatg
ctgaccgggctcgcccgtgacggcgggctgtatctgcccgaagtctggccacagctctct
cccgagaccatcgccggcctgttcggccggccttactgggaggtcgccgtcgaggtgatc
cggccgttcgtggccggcgagatttccgacgccgagctcggccggatggccaacgaggcc
tatgcgaccttccgtcatcccgcggtggtgccgctgcgccagaccggcccgagccagttc
gtgctcgagctgttccacggcccgacgctggcgttcaaggacgtcgcgatgcagttgctg
tcgcggctgatggatcacgtgctggagaagcgcaagcagcgtaccaccatcgtggtcgca
acctccggcgacaccggcggggccgcggtcgacgctttcgccaatctgaacaatgtcgat
ctcgtggtgctgtttccgcatggccggatctccgacgtgcagcggatgatgatgacgacc
tcggcggcgccgaacgtccatgcgctggcgatcgaggggcatttcgacgattgccaggcg
atcgtgaagggcctgttcaatcatcacgcctttcgcgacaaggtcgcgctgtccggcgtc
aattcgatcaactgggcgcggatcgtcgcccaggtggtgtattacttcaccagcgcggtg
gcgctcggggcgccgaaccggcaggtcgacttcaccgtgccgaccggcaatttcggcgac
atcttcgccggctacgtcgccaagaagatgggcctgccggtgcggcggctgaagatcgcc
gccaacgtcaacgacatcctggcgcggacgctgaagaccggcatctacgaggtgcgcgag
gtgcacgccaccacctcgccgtcgatggacatccaggtgtcctcgaatttcgagcggctg
ctgttcgaggcgaccggccgcgacgccgcgcaggtgcgggcgctgatgggctcgctcgcc
cagtccggccgtttcgtgctgccggatgcggtgctggcggctatccgcgaggaattcgac
gccggccgtgccgacgagaccgagaccgaggcggcgatccgcgccgcctggcgcgaggcc
ggcgatctggtcgatccgcacaccgccgtcgccctggcggtcgctgatcgcgacaccacg
gacccaaccgtccccaacatcgttctgtccaccgcgcacgcggccaaattccctgacgcg
gtcgaggccgcctgtggaatgcggccggagttgccggcctggctcgacggtttgatgagc
gggacggagcagatgcaagtgatgccccgcgatcaggcggcgatcgaacgccacgtgctg
tccatcagccgtgcggccaaacaaggagctgtcggatga

DBGET integrated database retrieval system