KEGG   Rhodopseudomonas palustris BisB5: RPD_0822Help
Entry
RPD_0822          CDS       T00345                                 

Definition
(GenBank) L-threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
rpd  Rhodopseudomonas palustris BisB5
Pathway
rpd00260  Glycine, serine and threonine metabolism
rpd00750  Vitamin B6 metabolism
rpd01100  Metabolic pathways
rpd01110  Biosynthesis of secondary metabolites
rpd01120  Microbial metabolism in diverse environments
rpd01230  Biosynthesis of amino acids
Module
rpd_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:rpd00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RPD_0822
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    RPD_0822
Enzymes [BR:rpd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     RPD_0822
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP GAF_2 Bcl-2
Motif
Other DBs
NCBI-ProteinID: ABE38060
JGI: RPD0822
UniProt: Q13CX9
Position
925454..926872
Genome map
AA seq 472 aa AA seqDB search
MTTYVSTRGEAPRLGFCDVMLTGLARDGGLYLPEVWPQLSPETIAGLFGRPYWEVAVEVI
RPFVAGEISDAELGRMANEAYATFRHPAVVPLRQTGPSQFVLELFHGPTLAFKDVAMQLL
SRLMDHVLEKRKQRTTIVVATSGDTGGAAVDAFANLNNVDLVVLFPHGRISDVQRMMMTT
SAAPNVHALAIEGHFDDCQAIVKGLFNHHAFRDKVALSGVNSINWARIVAQVVYYFTSAV
ALGAPNRQVDFTVPTGNFGDIFAGYVAKKMGLPVRRLKIAANVNDILARTLKTGIYEVRE
VHATTSPSMDIQVSSNFERLLFEATGRDAAQVRALMGSLAQSGRFVLPDAVLAAIREEFD
AGRADETETEAAIRAAWREAGDLVDPHTAVALAVADRDTTDPTVPNIVLSTAHAAKFPDA
VEAACGMRPELPAWLDGLMSGTEQMQVMPRDQAAIERHVLSISRAAKQGAVG
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
ttgacgacctacgtttcgacccggggtgaagccccgcgcctcggcttttgcgacgtgatg
ctgaccgggctcgcccgtgacggcgggctgtatctgcccgaagtctggccacagctctct
cccgagaccatcgccggcctgttcggccggccttactgggaggtcgccgtcgaggtgatc
cggccgttcgtggccggcgagatttccgacgccgagctcggccggatggccaacgaggcc
tatgcgaccttccgtcatcccgcggtggtgccgctgcgccagaccggcccgagccagttc
gtgctcgagctgttccacggcccgacgctggcgttcaaggacgtcgcgatgcagttgctg
tcgcggctgatggatcacgtgctggagaagcgcaagcagcgtaccaccatcgtggtcgca
acctccggcgacaccggcggggccgcggtcgacgctttcgccaatctgaacaatgtcgat
ctcgtggtgctgtttccgcatggccggatctccgacgtgcagcggatgatgatgacgacc
tcggcggcgccgaacgtccatgcgctggcgatcgaggggcatttcgacgattgccaggcg
atcgtgaagggcctgttcaatcatcacgcctttcgcgacaaggtcgcgctgtccggcgtc
aattcgatcaactgggcgcggatcgtcgcccaggtggtgtattacttcaccagcgcggtg
gcgctcggggcgccgaaccggcaggtcgacttcaccgtgccgaccggcaatttcggcgac
atcttcgccggctacgtcgccaagaagatgggcctgccggtgcggcggctgaagatcgcc
gccaacgtcaacgacatcctggcgcggacgctgaagaccggcatctacgaggtgcgcgag
gtgcacgccaccacctcgccgtcgatggacatccaggtgtcctcgaatttcgagcggctg
ctgttcgaggcgaccggccgcgacgccgcgcaggtgcgggcgctgatgggctcgctcgcc
cagtccggccgtttcgtgctgccggatgcggtgctggcggctatccgcgaggaattcgac
gccggccgtgccgacgagaccgagaccgaggcggcgatccgcgccgcctggcgcgaggcc
ggcgatctggtcgatccgcacaccgccgtcgccctggcggtcgctgatcgcgacaccacg
gacccaaccgtccccaacatcgttctgtccaccgcgcacgcggccaaattccctgacgcg
gtcgaggccgcctgtggaatgcggccggagttgccggcctggctcgacggtttgatgagc
gggacggagcagatgcaagtgatgccccgcgatcaggcggcgatcgaacgccacgtgctg
tccatcagccgtgcggccaaacaaggagctgtcggatga

DBGET integrated database retrieval system