KEGG   Rhodopseudomonas palustris BisB5: RPD_0870Help
Entry
RPD_0870          CDS       T00345                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
rpd  Rhodopseudomonas palustris BisB5
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rpd00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    RPD_0870
   00052 Galactose metabolism
    RPD_0870
   00500 Starch and sucrose metabolism
    RPD_0870
   00520 Amino sugar and nucleotide sugar metabolism
    RPD_0870
Enzymes [BR:rpd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     RPD_0870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(976039..976911)
Genome map
AA seq 290 aa AA seqDB search
MKIRKAVFPVAGLGTRVLPATKAMPKEMLTIVDRPLIQYVVDEAKEAGIEHFIFVTGRNK
GMIEDHFDRQFELDVTLEKRNKTSEMAILARDQPEAGAMSFTRQQAPHGLGHAVWCARDI
VGNEPFAVVLPDELVLNSPGCLKQMIQAAERLGDKANVIAVEEVPADMTHQYGICGVGKR
DGNIFEIDGMIEKPKPGTAPSNLSITGRYILQPEIFKILATQERGAGNEIQLTDAMIGLS
ATQKFYGVEFEGERHDCGSKAGFLRANIAFAMRRDDLRDGLRADMQRYLA
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatccgtaaagccgtgtttccggtcgccggcctcggcacccgcgtccttcccgcc
accaaggcgatgccgaaggagatgctcacaatcgtcgacagaccgctgatccagtatgtc
gtcgatgaggccaaggaagccggcatcgaacacttcatcttcgtcaccggccgcaacaag
ggcatgatcgaggatcatttcgaccgccagttcgaactcgacgtgaccctggagaagcgc
aacaagacgtcggaaatggcaatcctggcgcgcgaccagcccgaggccggcgcgatgagc
ttcacccgccagcaggcgccgcacggtctcggccacgccgtctggtgcgcccgcgacatc
gtcggcaacgagccgttcgcggtggtgctgccggacgagctggtgctcaactcgcccggc
tgcctcaagcagatgatccaggccgcggaacgactcggcgacaaggccaatgtcatcgcg
gtcgaggaagtgccggccgacatgacccatcaatacggcatctgcggcgtcggcaagcgc
gacggcaacatcttcgagatcgacggcatgatcgagaagccgaagcccggcaccgcgccg
tcgaacctgtcgatcaccggccgctacatcctgcagcccgagatcttcaagattctcgcg
acccaggagcgcggcgccggcaacgagatccagctcaccgacgccatgatcggactgtcc
gcgacgcagaaattctacggcgtcgaattcgagggcgagcgtcacgattgcggctcgaag
gccggcttcctccgcgccaacatcgcgttcgcgatgcgacgcgacgatctgcgcgacggg
ctgcgcgccgacatgcagcgatatctcgcctga

DBGET integrated database retrieval system