KEGG   Rhodopseudomonas palustris BisB5: RPD_0950Help
Entry
RPD_0950          CDS       T00345                                 

Definition
arginase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
rpd  Rhodopseudomonas palustris BisB5
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:rpd01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:rpd00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1067544..1068530)
Genome map
AA seq 328 aa AA seqDB search
MTPSGSALPTDVPRRVALLGVPIEIGAGLRGTLMGPAALRTAGIGRLLEQLRIEVEDHGD
MTRPQRDRGNDPTPANANFYGEVRSWVGAISARAYELAQSGAVPLFMGGDHSLSMGSVNG
VARYWQTQGKPLFVLWLDAHADYNTPTTTLTANMHGMSAAFLCGEPGLDDLLGDAPRVPI
PASQLDLFGIRSIDPLEKELVRARAIPVVDMRAIDEFGVGVLIRRVIDRVRAAGGVLHLS
FDVDFLDPAVAPGVGTTVPGGATYREAHLIMELLHDSGLVRSLDVVELNPFLDERGRTAR
VAVELIGSLFGMQITDRQTPSNALLPGE
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgacgccgtccggttccgcgctcccgactgatgtcccgcgccgcgtcgcgctgctcggc
gtgccgatcgaaatcggcgccggactgcgcggcacgctgatgggccccgcggcgctgcgc
accgccggcatcggccggctgctggaacagcttcgcatcgaggtcgaggaccatggcgac
atgacccggcctcaacgcgaccgtggcaacgatccgacgccggccaacgccaatttctac
ggcgaggtgcggagttgggtcggcgcgatctcggcgcgggcctacgagctggcgcagtcc
ggcgcggtgccgctgttcatgggcggcgatcacagcctgtcgatgggctcggtcaacggc
gtcgcgcgctactggcagacgcaaggcaagccgctgttcgtgctgtggctcgacgcccat
gccgactacaacacgccaacgacgacgctgaccgccaacatgcacggcatgtcggcggcg
ttcctgtgcggcgagcccgggctcgacgatctgctcggcgacgcgccgcgggtgccgatc
cccgcaagccagctcgacctgttcggcatccgctcgatcgacccgctcgagaaggagctg
gtgcgcgcgcgggcgatcccggtggtcgatatgcgcgcgatcgacgaattcggcgtcggc
gtgctgatccgccgggtgatcgaccgcgtccgcgccgcgggcggcgtgctgcatctgtcg
ttcgacgtcgacttcctcgaccccgccgttgcgccgggcgtcggcaccacggtgccgggc
ggcgcgacctatcgggaggcgcatctgatcatggagctgctgcacgattccggcctggtg
cgctcgctcgacgtggtcgagctcaacccgttcctcgacgaacgcggccgcaccgcccgg
gtcgcggtggaattaatcggcagcctgttcggaatgcagatcaccgaccgccagaccccc
agcaacgcgctgctgccgggcgaatag

DBGET integrated database retrieval system