KEGG   Rhodopseudomonas palustris BisB5: RPD_1213Help
Entry
RPD_1213          CDS       T00345                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
rpd  Rhodopseudomonas palustris BisB5
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:rpd00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1372880..1373764
Genome map
AA seq 294 aa AA seqDB search
MTALSEQARAKVNLTLRVVGRRVDGYHDLESVVAFADCADRLTLHPGAELSLVMSGPGAQ
DCGDTSDNLVLKATRLLAERVPNLRTGGFVLDKHLPVAAGIGGGSADAAAALRLLARANE
LSADDPRVVEAARLTGADVPVCLPSKPCVMTGVGENLSPLQLPRLPAVMVNPRVPVATKD
VFAALGLRAGQLNVGVVDLLKSTGWPTDGSSAADWIAAVKRGTNDLEAPALKVESVVGDV
LRALAALPGVRLSRMSGSGATCFALFANDDDAQAGAQLLKAAQPGWWVHAGALS
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgactgcgctgagtgagcaggcgcgcgccaaggtaaacctgaccctgcgggtggtgggc
cggcgcgtcgacggctatcacgatctcgaaagcgtggtggcgttcgccgattgcgccgat
cgcctgacgctgcatcccggcgccgagctcagcctggtcatgtccgggccgggcgcgcag
gattgcggcgacacctccgacaatctggtgctgaaggcgacccgcctgctcgccgaacgc
gtgccgaacctgcgcaccggcggctttgtcctcgacaagcatctgccggtggccgccgga
atcggcggtggctcggccgacgcagcggcggcgttacggctgctcgcccgcgccaacgaa
ttgtccgccgacgatccgcgcgtggtcgaggcggcccggctcaccggcgccgacgtcccg
gtctgcctgccttccaagccatgcgtcatgaccggcgtcggcgagaatctctccccgctg
caattgccgcggttgcctgcggtgatggtcaatccacgcgtgccggtggcgaccaaggac
gtgtttgccgcgcttggcctgcgcgctggccagctcaatgtcggcgtcgtcgatttgctg
aaatcgaccggctggccgaccgacgggtcctccgcggccgactggatcgcggcggtcaag
cgcggcaccaacgatctcgaagcgcctgcgctgaaagtcgagtcggtcgttggcgacgtg
ttgcgggcgctggccgcgctgccgggcgtgcggttgtcgcggatgtccggctcgggcgcc
acttgcttcgcgctgttcgccaatgacgacgacgcgcaggccggcgcgcaactgctgaag
gccgcgcagcccggctggtgggttcacgccggcgcgctgagctga

DBGET integrated database retrieval system