KEGG   Rhodopseudomonas palustris BisB5: RPD_1213Help
Entry
RPD_1213          CDS       T00345                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
rpd  Rhodopseudomonas palustris BisB5
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rpd00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    RPD_1213
Enzymes [BR:rpd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     RPD_1213
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1372880..1373764
Genome map
AA seq 294 aa AA seqDB search
MTALSEQARAKVNLTLRVVGRRVDGYHDLESVVAFADCADRLTLHPGAELSLVMSGPGAQ
DCGDTSDNLVLKATRLLAERVPNLRTGGFVLDKHLPVAAGIGGGSADAAAALRLLARANE
LSADDPRVVEAARLTGADVPVCLPSKPCVMTGVGENLSPLQLPRLPAVMVNPRVPVATKD
VFAALGLRAGQLNVGVVDLLKSTGWPTDGSSAADWIAAVKRGTNDLEAPALKVESVVGDV
LRALAALPGVRLSRMSGSGATCFALFANDDDAQAGAQLLKAAQPGWWVHAGALS
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgactgcgctgagtgagcaggcgcgcgccaaggtaaacctgaccctgcgggtggtgggc
cggcgcgtcgacggctatcacgatctcgaaagcgtggtggcgttcgccgattgcgccgat
cgcctgacgctgcatcccggcgccgagctcagcctggtcatgtccgggccgggcgcgcag
gattgcggcgacacctccgacaatctggtgctgaaggcgacccgcctgctcgccgaacgc
gtgccgaacctgcgcaccggcggctttgtcctcgacaagcatctgccggtggccgccgga
atcggcggtggctcggccgacgcagcggcggcgttacggctgctcgcccgcgccaacgaa
ttgtccgccgacgatccgcgcgtggtcgaggcggcccggctcaccggcgccgacgtcccg
gtctgcctgccttccaagccatgcgtcatgaccggcgtcggcgagaatctctccccgctg
caattgccgcggttgcctgcggtgatggtcaatccacgcgtgccggtggcgaccaaggac
gtgtttgccgcgcttggcctgcgcgctggccagctcaatgtcggcgtcgtcgatttgctg
aaatcgaccggctggccgaccgacgggtcctccgcggccgactggatcgcggcggtcaag
cgcggcaccaacgatctcgaagcgcctgcgctgaaagtcgagtcggtcgttggcgacgtg
ttgcgggcgctggccgcgctgccgggcgtgcggttgtcgcggatgtccggctcgggcgcc
acttgcttcgcgctgttcgccaatgacgacgacgcgcaggccggcgcgcaactgctgaag
gccgcgcagcccggctggtgggttcacgccggcgcgctgagctga

DBGET integrated database retrieval system