KEGG   Rhodopseudomonas palustris BisB5: RPD_1250Help
Entry
RPD_1250          CDS       T00345                                 

Definition
zinc-binding alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
rpd  Rhodopseudomonas palustris BisB5
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rpd00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    RPD_1250
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RPD_1250
  Lipid metabolism
   00071 Fatty acid degradation
    RPD_1250
  Amino acid metabolism
   00350 Tyrosine metabolism
    RPD_1250
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    RPD_1250
   00626 Naphthalene degradation
    RPD_1250
Enzymes [BR:rpd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     RPD_1250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1413317..1414336
Genome map
AA seq 339 aa AA seqDB search
MRAMVLREHGGLEKLSFDSNFPDPDIGPGDVLLRVRATSLNYHDIFTRRGMPGIKIPLPV
IMGLDVAGEIVKVGEGVEGWKAGDRVLVDPLNRVEGGLMGETMNGGLAELCKARAHQLVR
IPDNVSFEQAAALPVAYGTAHRMMTTNGHVKAGEKVLILGASGGVGVCCVQLAKIAGAYV
IACAGSEEKGQRLKEVGADEVILYTKEDFMQVVRQRHGRPQRVGGGSSENGGVDVVVNFT
GGDTWVKSLRTLKLGGRILTCGATAGYDPAEDLRVIWTFELQVRGSNGWERDDIEKLFAL
LASGKLRAQVDKAFPLEQAADALRMLEDRTVFGKVVVTP
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcaatggtcctgcgggaacatggagggctggagaagctctcgttcgattcgaat
tttcccgatccggatatcggacccggcgacgttctgctgcgcgtgcgtgcaacgtcgctg
aactatcacgatatcttcacccgtcgcggcatgccgggcatcaagatcccgctgccggtg
atcatggggctcgacgtcgcgggcgagatcgtgaaggtcggtgagggcgtcgaaggctgg
aaggccggcgaccgtgtgctggtcgatccgctcaaccgcgtcgaaggcgggctgatgggc
gagaccatgaacggcggcctcgccgagctgtgcaaggcgcgcgcgcatcagctcgtgcgc
atccccgacaatgtcagcttcgagcaggccgcggcgctgccggtcgcctacggcaccgcg
catcgcatgatgaccacaaacggtcacgtcaaggccggcgagaaggtgctgatcctgggc
gccagcggcggcgtcggcgtgtgctgcgtgcagctcgccaagatcgccggcgcctatgtg
atcgcctgcgccggctccgaagaaaaaggccagcgcctgaaggaggtcggcgccgacgaa
gtcatcctctacaccaaggaagacttcatgcaggtggtgcgtcagcgccacggccggccg
cagcgggtcggcggcggctcgtccgaaaacggcggcgtcgatgtcgtggtcaacttcacc
ggcggcgacacctgggtcaaatcgcttcgcacgctgaagctcggcggccgtatcctgacc
tgcggcgcgaccgcgggctacgatccggccgaagatctgcgcgtgatctggacgttcgag
ctgcaggtccgcggctccaacggctgggagcgcgacgacatcgagaagctgttcgcgttg
ttggcctccggcaagctccgcgcccaggtcgacaaggccttcccgctcgagcaggcggcg
gacgcgctgcggatgctggaagaccgcaccgtgttcggcaaggtcgtggtgacgccatga

DBGET integrated database retrieval system