KEGG   Rhodopseudomonas palustris BisB5: RPD_1383Help
Entry
RPD_1383          CDS       T00345                                 

Definition
glutaminase (EC:3.5.1.2)
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
rpd  Rhodopseudomonas palustris BisB5
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rpd00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    RPD_1383
   00330 Arginine and proline metabolism
    RPD_1383
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    RPD_1383
Enzymes [BR:rpd01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     RPD_1383
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1553187..1554122
Genome map
AA seq 311 aa AA seqDB search
MSTDLLDRTVAEIAEEMAQRTDRGEVANYIPELARVDPQGFGLVVIDADGHVAAGGDADL
PFSIQSISKVFTLTLALGKAGDRVWRRVGREPSGTAFNSIVQLERERGIPRNPFINAGAI
AVTDLILSGHQPREALGEILRFMQFLAADSAITIDEAVAASEQRTGFRNAALANYMKSFG
VLDNPVDYTLGVYFHHCAIAMSCRQLAMAGRFLAHNGRNPSTGHNVVSAQRARRINALML
TCGHYDGSGEFAYRVGLPGKSGVGGGVLAVAPGKASIAVWSPGLDASGNSHLGRIALEAL
TKRLGWSIFGV
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgagcacggaccttctcgaccgcaccgtcgcagagatcgccgaagagatggcgcagcgg
accgaccgcggcgaggtggcgaactacattcccgaactggcgcgggtcgatccgcagggc
ttcggcctcgtggtgatcgacgccgatggccatgtcgcggccggcggtgacgccgatctg
ccgttctcgatccagagcatctcgaaagtgttcacgctgacgctggcgctgggcaaagcc
ggcgaccgggtgtggcgcagggtcggccgcgagccgtccggcacggcgttcaattcgatc
gtccagctcgagcgcgagcgcggcattccgcgcaatccattcatcaatgccggcgcgatc
gccgtcaccgacctgattctgtcggggcatcagccccgcgaggcgctcggcgaaattctc
cgcttcatgcaattcctcgccgcggattcggcgatcacgatcgacgaggcggtggcggcc
tccgagcaacgcaccggcttccgcaacgctgcgctcgccaattacatgaaatccttcggc
gtgctcgacaatccggtcgactacacgctcggcgtttatttccaccattgcgcgatcgcg
atgagctgccgccaacttgcgatggccgggcgcttcctcgcgcataacggccgcaacccg
tcgaccggtcacaacgtggtgtcggcgcagcgggcgcggcgcatcaacgcgctgatgctg
acctgcgggcattacgacggttcgggcgagttcgcctatcgggtcggtctgccggggaaa
agcggggtgggcgggggcgtgctggccgtggcgccgggcaaggcctcgatcgcggtgtgg
tcgccggggctcgatgcctcggggaattcccatctcggccggattgcgctggaagcgctg
accaagcggctgggctggtcgattttcggcgtctga

  All links  
No link information was found.   
DBGET integrated database retrieval system