KEGG   Rhodopseudomonas palustris BisB5: RPD_1388Help
Entry
RPD_1388          CDS       T00345                                 

Definition
3-hydroxybutyrate dehydrogenase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
rpd  Rhodopseudomonas palustris BisB5
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rpd00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    RPD_1388
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    RPD_1388
Enzymes [BR:rpd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     RPD_1388
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1556963..1557751
Genome map
AA seq 262 aa AA seqDB search
MANLTGKTAVVTGSTSGIGLAYARAFAKSGANVVLNGMGEPDAIEAARKAIETDFAVKAL
YSPADMLKPAEIAEMIKLGEKTLGSVDILVNNAGIQFVSPVEEFPVDKWDAIIAINLSSA
FHGIRAAVPGMKKRGWGRIINTASAHSLVASPFKSAYVAAKHGIAGLTKTVALELATHKI
TCNCISPGYVWTPLVEKQIPDTMKARGLTKDQVINDVLLQAQPTKQFVTSEQVAALAVYL
CGDDASQITGANLSMDGGWTAA
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atggctaatctcaccggcaaaaccgcggtcgtgaccggatcgacctcgggcatcgggctg
gcctatgcgcgcgccttcgccaagtcgggcgccaatgtggtgctgaacggcatgggcgag
cctgatgcgatcgaggcggcgcgcaaggcgatcgagaccgacttcgcggtgaaggcgctg
tattcgccggccgacatgctgaagccggcggagatcgccgagatgatcaagctcggcgag
aaaacactcggctcggtcgacatcctggtcaacaatgccggcatccagttcgtctcgccg
gtcgaggagtttccggtcgacaagtgggacgcgatcatcgccatcaacctgtcgtcggcg
ttccacggcatccgcgccgcggtgcccggcatgaagaagcgcggctggggccgcatcatc
aacaccgcctcggcgcattcgctggtcgcctcgccgttcaagtcggcctatgtcgccgcc
aagcacggcatcgccggcctgaccaagacggtggcgctggagctcgcgacccataagatc
acctgcaactgcatttcgccgggctatgtctggactccgctggtcgagaagcagatcccg
gatacgatgaaggcgcgcggcctgaccaaggatcaggtgatcaacgacgtgctgctgcag
gcgcagccgaccaagcaattcgtcacgtccgaacaggtcgcggcgctggccgtctatctg
tgcggcgacgacgccagccagatcaccggcgccaacctgtcgatggacggcggctggacc
gcggcgtag

DBGET integrated database retrieval system