KEGG   Rhodopseudomonas palustris BisB5: RPD_1388Help
Entry
RPD_1388          CDS       T00345                                 

Definition
3-hydroxybutyrate dehydrogenase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
rpd  Rhodopseudomonas palustris BisB5
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:rpd00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:rpd00072]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1556963..1557751
Genome map
AA seq 262 aa AA seqDB search
MANLTGKTAVVTGSTSGIGLAYARAFAKSGANVVLNGMGEPDAIEAARKAIETDFAVKAL
YSPADMLKPAEIAEMIKLGEKTLGSVDILVNNAGIQFVSPVEEFPVDKWDAIIAINLSSA
FHGIRAAVPGMKKRGWGRIINTASAHSLVASPFKSAYVAAKHGIAGLTKTVALELATHKI
TCNCISPGYVWTPLVEKQIPDTMKARGLTKDQVINDVLLQAQPTKQFVTSEQVAALAVYL
CGDDASQITGANLSMDGGWTAA
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atggctaatctcaccggcaaaaccgcggtcgtgaccggatcgacctcgggcatcgggctg
gcctatgcgcgcgccttcgccaagtcgggcgccaatgtggtgctgaacggcatgggcgag
cctgatgcgatcgaggcggcgcgcaaggcgatcgagaccgacttcgcggtgaaggcgctg
tattcgccggccgacatgctgaagccggcggagatcgccgagatgatcaagctcggcgag
aaaacactcggctcggtcgacatcctggtcaacaatgccggcatccagttcgtctcgccg
gtcgaggagtttccggtcgacaagtgggacgcgatcatcgccatcaacctgtcgtcggcg
ttccacggcatccgcgccgcggtgcccggcatgaagaagcgcggctggggccgcatcatc
aacaccgcctcggcgcattcgctggtcgcctcgccgttcaagtcggcctatgtcgccgcc
aagcacggcatcgccggcctgaccaagacggtggcgctggagctcgcgacccataagatc
acctgcaactgcatttcgccgggctatgtctggactccgctggtcgagaagcagatcccg
gatacgatgaaggcgcgcggcctgaccaaggatcaggtgatcaacgacgtgctgctgcag
gcgcagccgaccaagcaattcgtcacgtccgaacaggtcgcggcgctggccgtctatctg
tgcggcgacgacgccagccagatcaccggcgccaacctgtcgatggacggcggctggacc
gcggcgtag

DBGET integrated database retrieval system