KEGG   Rhodopseudomonas palustris BisB5: RPD_1464Help
Entry
RPD_1464          CDS       T00345                                 

Definition
phosphoglucomutase/phosphomannomutase alpha/beta/subunit
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
rpd  Rhodopseudomonas palustris BisB5
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rpd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RPD_1464
   00030 Pentose phosphate pathway
    RPD_1464
   00051 Fructose and mannose metabolism
    RPD_1464
   00052 Galactose metabolism
    RPD_1464
   00500 Starch and sucrose metabolism
    RPD_1464
   00520 Amino sugar and nucleotide sugar metabolism
    RPD_1464
  Nucleotide metabolism
   00230 Purine metabolism
    RPD_1464
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    RPD_1464
Enzymes [BR:rpd01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     RPD_1464
    5.4.2.8  phosphomannomutase
     RPD_1464
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1633440..1634966)
Genome map
AA seq 508 aa AA seqDB search
MLTTHREPILMFPKPKTSLLPNTYAYESEPMVKPTGFREYDARWLFGKEINLMGVQALGM
GLGTLIAELGQKQEIVTGHDFRSYSASIKYALISGLMASGCKVHDIGLAVTPMAYFAQFD
LDVPCVAMVTASHNDNGWTGVKMGANRPLTFGPDEMGRLKQIVLDAQFKSGAGSYVFHEN
YPARYIADLTERSRLTRKLKVVVACGNGTAGAFAPQVMEAIGCDVIPLDTELDHNFPKYN
PNPEDMEMLHAIRDAVLLHKADLGLGFDGDGDRCGVVDNTGEEIFADKVGVMLARDMSAI
NANARFVVDVKSTGLFATDPVLQAQGARTEYWKTGHSYMKRRTHELQALAGFEKSGHFFF
NAPLGRGYDDGLVSAIAICEMLDRAPDRSMSDLKTALPKTWSSPTMSPHCDDETKYGVID
AVVKHFQAAKANGDEVAGQPIRDLVTVNGVRVTCQDGSWGLVRASSNKPELVVVVESPVS
EARMHEMFEAMNVVLRRHPEVGAYNQTI
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
gtgctcacaactcatcgcgagccgatcctaatgtttcccaagcccaagacatccctgctc
cccaacacctatgcttacgaatccgagccgatggtgaagcccaccggattccgcgagtac
gatgcccgctggctgttcggcaaagagatcaatctgatgggcgttcaggcgctgggcatg
gggctcggcacgctgatcgcggaactcgggcagaagcaggagatcgtcaccggccacgat
ttccgcagctactcggcgtcgatcaaatatgcgctgatttccgggctgatggcctccggc
tgcaaggtgcacgacatcggactcgcggtgacgccgatggcgtatttcgcgcagttcgat
ctcgatgtgccctgcgtcgcgatggtgaccgcctcgcataacgacaatggctggaccggc
gtcaagatgggcgccaaccggccgctgaccttcgggccggacgagatgggtcggctgaaa
cagatcgtgctcgatgcgcagttcaagagcggcgccggctcctacgtgtttcacgagaat
tatccggcgcgctacatcgccgacctgaccgaacgaagccggttgacgcgcaagctgaag
gtcgtggtcgcctgcggcaacggcaccgccggcgcgttcgcgccgcaggtgatggaagcg
atcggctgcgacgtcatcccgctcgacaccgagctcgaccacaacttccccaaatacaat
ccgaatcccgaagacatggagatgctgcacgcgatccgcgacgcggtgctgctgcacaag
gccgatctcggcctcggtttcgacggcgacggcgaccgctgcggcgtggtcgacaacacc
ggcgaggaaatcttcgccgacaaggtcggcgtgatgctggcgcgcgacatgtcggcgatc
aacgccaacgcgcgattcgtggtcgacgtgaaatcgaccggcctgttcgcgaccgatccg
gtgctgcaggcgcagggcgcgcgcaccgaatattggaagaccggccattcctacatgaag
cgccgcacccacgagctgcaggcgctggccgggttcgagaagtcgggccacttcttcttc
aatgccccgcttggccgcggctatgacgacggcctggtatcggcgatcgcgatctgcgaa
atgctcgatcgtgcgccggacagatcgatgtcggatctgaagaccgcgctgcccaagacc
tggtcgtcgccgacgatgtcgccgcattgcgacgacgagaccaaatacggcgtgatcgat
gccgtcgtgaagcacttccaggcggcaaaggccaatggtgacgaggtcgccggccagccg
atccgcgatctcgtcaccgtcaacggcgtccgggtgacctgccaggacggcagttgggga
ctggttcgcgcctcgtcgaacaagccggagcttgtcgtcgtggtcgagagcccggtgtca
gaggcgcggatgcacgagatgttcgaggcgatgaacgtcgttctgcgccgccatcccgaa
gtcggcgcctataaccagacgatctga

DBGET integrated database retrieval system