KEGG   Rhodopseudomonas palustris BisB5: RPD_1511Help
Entry
RPD_1511          CDS       T00345                                 

Definition
pyruvate/2-ketoisovalerate 2-oxoacid:acceptor oxidoreductase subunit delta
Orthology
K18358  
phenylglyoxylate dehydrogenase delta subunit [EC:1.2.1.58]
Organism
rpd  Rhodopseudomonas palustris BisB5
Pathway
Phenylalanine metabolism
Brite
KEGG Orthology (KO) [BR:rpd00001]
 Metabolism
  Amino acid metabolism
   00360 Phenylalanine metabolism
    RPD_1511
Enzymes [BR:rpd01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.58  phenylglyoxylate dehydrogenase (acylating)
     RPD_1511
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1685952..1686254
Genome map
AA seq 100 aa AA seqDB search
MSSHRAYPMFDPGQAGVPDDLCPIATDINPMLPGDWRSMRPVVDREKCVKCAVCWLYCPV
QCMVERPAWFDVDLRTCKGCGICANECPHRAIAMVEETAG
NT seq 303 nt NT seq  +upstreamnt  +downstreamnt
atgagcagccatcgcgcctatccgatgttcgatccgggccaggccggcgtgcccgacgat
ctttgcccgatcgcaaccgacatcaacccgatgctgcccggcgactggcgcagcatgcgg
ccggtggtagaccgcgaaaaatgcgtcaaatgcgcggtgtgctggctgtattgcccggtg
caatgcatggtcgaacgcccggcctggttcgatgtcgatctgcgcacctgcaaggggtgc
ggcatctgcgccaacgaatgtccgcaccgcgcgatcgccatggtggaggagacggcggga
tga

DBGET integrated database retrieval system