KEGG   Rhodopseudomonas palustris BisB5: RPD_1512Help
Entry
RPD_1512          CDS       T00345                                 

Definition
pyruvate flavodoxin/ferredoxin oxidoreductase-like
Orthology
K18355  
phenylglyoxylate dehydrogenase alpha subunit [EC:1.2.1.58]
Organism
rpd  Rhodopseudomonas palustris BisB5
Pathway
Phenylalanine metabolism
Brite
KEGG Orthology (KO) [BR:rpd00001]
 Metabolism
  Amino acid metabolism
   00360 Phenylalanine metabolism
    RPD_1512
Enzymes [BR:rpd01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.58  phenylglyoxylate dehydrogenase (acylating)
     RPD_1512
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1686251..1687495
Genome map
AA seq 414 aa AA seqDB search
MSTAILEKDHAASNKPRHIVCEGNEAAALAVAMVRPDMVSVYPITPQSSLVEHLAKLVAD
GRMDAEIVDAEGEHSVLSVLQGAALAGGRTFTATCGPGLAFMFEPYFRTSGLRLPIVMAL
VTRDGITPQSVWGGHQDAMTVREVGWVQMYCETVQEVLDTTIMAFRIAEHHDVMLPVNIC
LDGNYLSYGAARVTLPEQSDVDAFMGDKDVNWHAALDPLRPMAVDPLTGGSGGKGPATFV
RYRKGQCRGMQNALRVITEVHAEYAARFGRSFAPLVEQYRMDDAEFALMTLGSMTGAAKD
AVDEARDAGKRVGIVKIKTFSPFPVEALRSALSGIKALGVVDRSVGFRWNCGPMYQEVQG
VLYRLGRHVPAASFIGGLAGADITVEHFHRVIDQTEALLTGAVPSGPVWINEND
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgagcacagcaatcctggagaaggaccacgcggcatccaacaagccacgccacatcgtt
tgcgaaggcaacgaggcggcggcgctggcggtggcgatggtgcggccggacatggtgtcg
gtctatccgatcacgccgcagtcgagcctggtcgaacatctggccaagctggtcgccgac
ggccggatggatgccgagatcgtcgacgccgagggcgagcactcggtgctctcggtgctg
cagggcgccgccctcgctggcggccggacgtttaccgccacctgcggtcccggactggcc
ttcatgttcgagccgtatttccggacctccggcctgcggctgccgatcgtgatggcgctg
gtgacgcgcgacggcatcacgccgcaatcggtctggggcggtcatcaggatgcgatgacc
gttcgcgaggtcggttgggtgcagatgtattgcgagacggtgcaggaggtgctcgacacc
acgatcatggcgttccgcatcgccgaacaccacgacgtcatgctgccggtcaatatctgc
ctcgacggcaactatctgtcctacggcgccgcgcgagtgacgctgcccgagcaatccgac
gtcgacgccttcatgggcgacaaggacgtcaactggcacgccgcgctcgatccgctccgg
ccgatggcggtcgacccgctcaccggcggctccggcggcaaggggccggccaccttcgtg
cgctatcgcaagggccagtgccgcggcatgcagaatgcgctgcgtgtgatcaccgaggtg
cacgcggaatatgccgcccggttcggccgcagcttcgcgccgctggtcgagcaatatcgc
atggacgacgccgagttcgcgttgatgacgctcggcagcatgaccggcgccgccaaggat
gcggtcgacgaggcgcgcgacgccggcaagcgcgtcggcatcgtcaagatcaagaccttc
agtccgtttccggtcgaggcgttgcggtcggcgctatccgggatcaaggcgctcggcgtg
gtcgatcgctcggtcggtttccggtggaattgcgggccgatgtatcaggaggtgcagggc
gtgctgtaccggctcggccgccatgtcccggccgccagtttcatcggcgggctggccggc
gccgatatcacggtcgagcatttccaccgcgtgatcgaccagaccgaagccctgctcacc
ggcgccgtgccgagcgggccggtctggatcaacgagaacgattga

DBGET integrated database retrieval system