KEGG   Rhodopseudomonas palustris BisB5: RPD_1514Help
Entry
RPD_1514          CDS       T00345                                 

Definition
thiamine pyrophosphate enzyme-like protein
Orthology
K00170  
pyruvate ferredoxin oxidoreductase, beta subunit [EC:1.2.7.1]
Organism
rpd  Rhodopseudomonas palustris BisB5
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Pyruvate:ferredoxin oxidoreductase
Class
Metabolism; Overview; Carbon metabolism [PATH:rpd01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:rpd00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:rpd00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:rpd00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:rpd00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:rpd00650]
Metabolism; Energy metabolism; Methane metabolism [PATH:rpd00680]
Metabolism; Xenobiotics biodegradation and metabolism; Nitrotoluene degradation [PATH:rpd00633]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1688756..1690084
Genome map
AA seq 442 aa AA seqDB search
MGQAYTTIAFDAAKCDGCRQCMSACATAKNGADDSARARLQVLPTDGGFELAMCRQCGDP
KCVTVCPAGALAKDGDTGVIGWDAGKCVDCLLCTVGCAYAGIARDETDGRVAKCDMCDGA
PACVAACPTAALSHITTARIYNEVGDWEDLFTPGLAGCQGCNTELLMRHALRRVGPDTVL
ATPPGCVPGMGSVGYNGLTGTKVPVFHPLLTNTAPMLAGVKRQLKRKGREVTAMAIAGDG
GASDVGFQSLSGAAERGEEILFMVVDNEGYMNTGMQRSSCTPYGAWTSTTPVGRESKGKT
QDAKNLPLLMVNHRCAYVATASTAFMQDLYDKLDKAIAASKQGFAYLHVYSPCTTGWRFP
TDQNMEVARKAVETNFVMLWEFTPSNGLHFTHPVDAPLPITDYLKAMGRFRHLDADQIRH
IQAKVDENRAIIEQLATGVRAA
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgggacaggcctacaccacgatcgccttcgacgccgccaaatgcgacggctgccggcaa
tgcatgagcgcctgcgccaccgccaagaacggcgccgacgacagcgcacgggcgcgcctc
caggtgctgccgacggacggcggcttcgaactggcgatgtgtcgccagtgcggcgatccg
aaatgcgtcaccgtctgtccggccggagcactggccaaggacggcgacaccggcgtgatc
ggatgggacgccggcaaatgcgtcgattgcctgctgtgcacggtcggctgcgcctatgcg
gggatcgcgcgcgacgagaccgacggccgcgtcgccaaatgcgatatgtgcgacggcgcg
ccggcctgcgtcgcagcctgcccgaccgcggcgctgagccacatcaccaccgcgcgcatc
tacaacgaagtcggcgactgggaggatttgttcacgcccggcctcgccggctgccagggc
tgcaacaccgaactgctgatgcgtcacgcgctgcgccgcgtcggtccggataccgtgctg
gcgacgccgccgggctgcgtgccggggatgggatcggtcggctataacggcctgaccggg
accaaggtgccggtgtttcatccactcctgaccaataccgcgccgatgctggcgggggtc
aagcgccagctcaagcgcaagggccgcgaggtgacggcgatggcgatcgccggcgacggc
ggcgcgtccgacgtcggcttccagtcgctgtcgggcgccgccgagcgcggcgaagaaatc
ctgttcatggtggtcgacaacgaaggctacatgaacaccgggatgcagcgatcgagctgc
acgccctacggcgcctggacctcgaccacgccggtgggacgcgagtccaagggcaagacc
caggacgccaagaacctgccgctgctgatggtcaaccatcgctgcgcctatgtggcgacc
gcttccaccgccttcatgcaggatctctacgacaagctcgacaaggcgatcgccgcctcc
aaacaaggcttcgcctatctgcatgtctactcgccctgcaccaccggctggcggtttcct
accgaccagaacatggaagtggcgcgcaaggcggtggagacgaatttcgtcatgctctgg
gaattcactccgagcaatggcctgcatttcacccatccggtcgacgcgccgctgccgatc
accgactacctcaaggcgatggggcgcttccgccatctcgacgccgatcagatccggcac
atccaggccaaggtcgacgagaaccgcgccatcatcgaacagctcgcgaccggggtgaga
gcggcctga

DBGET integrated database retrieval system