KEGG   Rhodopseudomonas palustris BisB5: RPD_1820Help
Entry
RPD_1820          CDS       T00345                                 

Definition
cytochrome P450
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
rpd  Rhodopseudomonas palustris BisB5
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Class
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:rpd00071]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:rpd00380]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:rpd00627]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2037686..2040913
Genome map
AA seq 1075 aa AA seqDB search
MPSTNKLDPIPHPPKKPVVGNMLSLDTTAPVQHLVRLAKELGPIFWLDMMGAPLVIVSGY
DLVDEISDEKRFDKAVRGALRRARAVGGDGLFTADTKEPNWSKAHNILLTPFGGRAMQSY
HPSMVDIAEQLVKKWERLNADDEIDVVHDMTALTLDTIGLCGFDYRFNSFYRRDYHPFVE
SLVRSLETIMMTRGLPLENLWMKKRRETLADDVVFMNAMVDEIIAERRKASESAADKKDM
LGAMLAGVDRATGEPLDDVNIRYQINTFLIAGHETTSGLLSCAIYALLKHPDVLQKAYDE
VDRVLGSDTAVRPSYQQVNQLSYITQILKETLRMWPPAPAYGVAPIKDEVIGGKYHLKRG
TFVTVLVLALHRDPAIWGPNPDAFDPENFSREAESKRPANAWKPFGNGQRACIGRGFAMH
EAALALGMILQRFQLIDHQRYRMVLKETLTIKPEGFKIKVRPRSDKDRGDFVAAGASQVS
TPALAQAAPRARPDHNTPLLVLYGSNLGTAEELATRVADLAELNGFSTRLGALDQYVGHL
PEEGGVLIFTASYNGAPPDNATQFVQWLSGDLPKDAFAKLRYAVFGCGNRDWTATYQAIP
RLVDERLAAHGGRNIFLRGEGDARDDLEGQFESWFAKLGPLAVKEFGIDAKFARAVDDAP
LYRIEPVAPAAGNAVAAAGGAVPMKVLANRELQDCAASGRSTRHIEIALPEGISYRVGDH
LSVMPRNDPALVAAVAQRLGFAPDDQIKLQVAPGRRAQLPIGEAISVGRLLGDFVELQQV
ATRKQIAVMAEHTRCPQTRPKLQALAGGDGAADEAYRAGVLAKRKSVYDLMQEHPACELP
LHAYLEMLSPLAPRYYSISSSPLRDPSRAAITVAVVDGPALSGRGHYRGVCSTWLAGRSV
GDTIHATVRATKAGFRLPDDDRVPLIMIGPGTGLAPFRGFLQERAARQQNGATLGPALLF
FGCRHPAQDYLYADELQGFAAEGVVELHTAFSRGEGPKTYVQHLIAAQKDRVFTLIEQGA
IIYVCGDGGKMEPDVRAALMAIHRERSGADAAAASTWIDDLGACNRYVLDVWASA
NT seq 3228 nt NT seq  +upstreamnt  +downstreamnt
atgccgtccaccaacaagctcgatccaattccgcatccgccgaagaagccggtggtcggc
aacatgctgtcgctcgatacgacggccccggtgcagcatctggtgcggctcgccaaggag
ctcgggccgatcttctggctcgacatgatgggcgcgccgctggtgatcgtgtcgggttac
gatctggtcgacgagatcagcgacgagaagcggttcgacaaggcggtgcgcggcgcgctg
cgccgggcgcgcgcggtcggcggcgacggcctgttcaccgccgacaccaaggagccgaac
tggagcaaggcgcacaacattctgctgacgccgttcggcggccgcgcgatgcagtcgtat
cacccgagcatggtcgatatcgccgagcagctcgtgaagaagtgggagcggctcaacgcc
gacgacgagatcgacgtcgtccacgacatgaccgcgctgacgctcgacaccatcggcctg
tgcggcttcgactatcgcttcaattcgttctatcgccgcgactaccaccccttcgtggaa
tcgctggtgcgctcgctcgagaccatcatgatgacccgcggcctgccgctggaaaatctc
tggatgaagaagcggcgggagacgctcgccgacgatgtcgtcttcatgaatgcgatggtc
gacgaaatcatcgccgagcgccgcaaggcgtcggaaagcgccgccgacaagaaggacatg
ctcggcgcgatgttggcgggcgtcgaccgcgccaccggcgagccgctcgacgacgtcaac
atccgctaccagatcaatacgttcctgatcgccggccacgagaccaccagcgggctgttg
tcctgcgcgatctacgcgctgctgaagcatcccgacgtgttgcagaaggcgtatgacgag
gtcgaccgcgtgctcggctccgacaccgccgtccggccgagctatcagcaggtcaaccag
ctcagctacatcacgcagattctgaaagagacgctgcgaatgtggccgccggcgccggcc
tacggcgtcgcgccgatcaaggacgaagtgatcggcggcaaatatcatctgaagcgcggc
accttcgtcaccgtgctggtgctggcgctgcatcgcgacccggcgatctgggggccgaac
ccggacgcgttcgatccggagaatttttcgcgggaagccgaatcgaagcggcccgccaat
gcctggaagccgttcggcaacggccagcgcgcctgcatcggccggggcttcgcgatgcac
gaggcggcgctggcgctcggcatgatcctgcagcgcttccagctgatcgatcaccagcgc
tatcgcatggtgctgaaggagacgctgacgatcaagcccgagggcttcaagatcaaggtg
cgtccgcgcagcgacaaggaccgcggcgatttcgtcgcggccggcgcatcgcaagtttcg
acgccggctctggcccaggccgcgccgcgcgcgcgtccggaccacaacacgccgctgctg
gtgctgtacggctccaacctcggcaccgccgaggagctggcgacccgcgtcgccgatctc
gccgaactcaacggcttttcgacgcggctcggtgcgctcgatcaatatgtcgggcacttg
ccggaagagggcggcgtgctgatcttcaccgcctcctacaacggcgcgccgccggacaat
gcgacccagttcgtgcaatggctgtctggcgatctgccgaaggatgcgttcgccaagctg
cgctacgccgtgttcggctgtggcaatcgcgactggaccgcgacctatcaggcgatcccg
cggctggtcgacgagcggctcgccgcgcatggcggccgcaacatcttcctgcgcggcgag
ggcgacgcccgcgacgatctcgaaggccagttcgaatcctggttcgccaaactcggcccg
ctggcggtgaaggagttcgggatcgacgccaaattcgctcgcgcggtcgatgatgcgccg
ctgtaccggatcgagccggtggcgcccgcagcggggaacgcggtcgccgcagcggggggc
gcggtgccgatgaaggtgctcgccaatcgcgagctgcaggattgcgccgcctcggggcgc
tcgacccgccatatcgagatcgcgctgccggaagggatcagctatcgcgtcggcgaccac
ctcagcgtgatgccgcgcaacgatccggcgctggtcgccgccgtcgcgcagcggctcggc
tttgcgccggatgatcagatcaagctgcaggtcgcgcccggccgccgcgcgcaattgccg
atcggcgaagcgatttcggtcggccgcctgctcggcgacttcgtcgaactgcagcaggtc
gcgacccgcaagcagatcgcagtcatggccgagcacacgcgctgtccgcagacccggccg
aagctgcaagcgctcgccggcggcgatggcgctgccgacgaggcctatcgcgccggcgtt
ctggcgaagcgcaagtcggtctatgatctgatgcaggagcatcccgcctgcgagttgccg
ctgcacgcttatctggaaatgctgtcgccgctggcgccgcgctactactcgatctcgtcg
tcgccgttgcgcgatccgtcgcgcgccgcgatcaccgtcgccgtggtcgatggcccggca
ttgtccggccgtggtcattatcgcggcgtctgctcgacctggctcgccggccgaagcgtc
ggcgacaccatccacgccacggtgcgcgcgaccaaagcaggtttccgcctgcccgacgac
gaccgcgtgccgctgatcatgatcgggccgggcaccgggctcgcgccgttccgcggcttc
ctgcaggagcgcgccgcgcgccagcagaacggcgcgacgctcggtccggcgctgctgttc
ttcggctgccgacatccggcgcaggactatctctatgccgacgagctgcagggcttcgct
gccgagggcgtcgtcgagctgcataccgcgttctcgcgcggcgaggggcccaagacctat
gtgcagcatctgattgccgcgcagaaggatcgggtgttcacgttgatcgagcagggcgcg
atcatctatgtctgtggcgacggcggcaaaatggagcccgacgtcagggcggcgctgatg
gcgatccatcgcgagcgcagcggcgccgatgctgcggcggcgtcgacatggatcgacgat
ctcggcgcatgcaatcgctatgtgctcgacgtctgggcgagcgcgtaa

DBGET integrated database retrieval system