KEGG   Rhodopseudomonas palustris BisB5: RPD_1820Help
Entry
RPD_1820          CDS       T00345                                 

Definition
cytochrome P450
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
rpd  Rhodopseudomonas palustris BisB5
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rpd00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    RPD_1820
  Amino acid metabolism
   00380 Tryptophan metabolism
    RPD_1820
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    RPD_1820
Enzymes [BR:rpd01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     RPD_1820
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     RPD_1820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2037686..2040913
Genome map
AA seq 1075 aa AA seqDB search
MPSTNKLDPIPHPPKKPVVGNMLSLDTTAPVQHLVRLAKELGPIFWLDMMGAPLVIVSGY
DLVDEISDEKRFDKAVRGALRRARAVGGDGLFTADTKEPNWSKAHNILLTPFGGRAMQSY
HPSMVDIAEQLVKKWERLNADDEIDVVHDMTALTLDTIGLCGFDYRFNSFYRRDYHPFVE
SLVRSLETIMMTRGLPLENLWMKKRRETLADDVVFMNAMVDEIIAERRKASESAADKKDM
LGAMLAGVDRATGEPLDDVNIRYQINTFLIAGHETTSGLLSCAIYALLKHPDVLQKAYDE
VDRVLGSDTAVRPSYQQVNQLSYITQILKETLRMWPPAPAYGVAPIKDEVIGGKYHLKRG
TFVTVLVLALHRDPAIWGPNPDAFDPENFSREAESKRPANAWKPFGNGQRACIGRGFAMH
EAALALGMILQRFQLIDHQRYRMVLKETLTIKPEGFKIKVRPRSDKDRGDFVAAGASQVS
TPALAQAAPRARPDHNTPLLVLYGSNLGTAEELATRVADLAELNGFSTRLGALDQYVGHL
PEEGGVLIFTASYNGAPPDNATQFVQWLSGDLPKDAFAKLRYAVFGCGNRDWTATYQAIP
RLVDERLAAHGGRNIFLRGEGDARDDLEGQFESWFAKLGPLAVKEFGIDAKFARAVDDAP
LYRIEPVAPAAGNAVAAAGGAVPMKVLANRELQDCAASGRSTRHIEIALPEGISYRVGDH
LSVMPRNDPALVAAVAQRLGFAPDDQIKLQVAPGRRAQLPIGEAISVGRLLGDFVELQQV
ATRKQIAVMAEHTRCPQTRPKLQALAGGDGAADEAYRAGVLAKRKSVYDLMQEHPACELP
LHAYLEMLSPLAPRYYSISSSPLRDPSRAAITVAVVDGPALSGRGHYRGVCSTWLAGRSV
GDTIHATVRATKAGFRLPDDDRVPLIMIGPGTGLAPFRGFLQERAARQQNGATLGPALLF
FGCRHPAQDYLYADELQGFAAEGVVELHTAFSRGEGPKTYVQHLIAAQKDRVFTLIEQGA
IIYVCGDGGKMEPDVRAALMAIHRERSGADAAAASTWIDDLGACNRYVLDVWASA
NT seq 3228 nt NT seq  +upstreamnt  +downstreamnt
atgccgtccaccaacaagctcgatccaattccgcatccgccgaagaagccggtggtcggc
aacatgctgtcgctcgatacgacggccccggtgcagcatctggtgcggctcgccaaggag
ctcgggccgatcttctggctcgacatgatgggcgcgccgctggtgatcgtgtcgggttac
gatctggtcgacgagatcagcgacgagaagcggttcgacaaggcggtgcgcggcgcgctg
cgccgggcgcgcgcggtcggcggcgacggcctgttcaccgccgacaccaaggagccgaac
tggagcaaggcgcacaacattctgctgacgccgttcggcggccgcgcgatgcagtcgtat
cacccgagcatggtcgatatcgccgagcagctcgtgaagaagtgggagcggctcaacgcc
gacgacgagatcgacgtcgtccacgacatgaccgcgctgacgctcgacaccatcggcctg
tgcggcttcgactatcgcttcaattcgttctatcgccgcgactaccaccccttcgtggaa
tcgctggtgcgctcgctcgagaccatcatgatgacccgcggcctgccgctggaaaatctc
tggatgaagaagcggcgggagacgctcgccgacgatgtcgtcttcatgaatgcgatggtc
gacgaaatcatcgccgagcgccgcaaggcgtcggaaagcgccgccgacaagaaggacatg
ctcggcgcgatgttggcgggcgtcgaccgcgccaccggcgagccgctcgacgacgtcaac
atccgctaccagatcaatacgttcctgatcgccggccacgagaccaccagcgggctgttg
tcctgcgcgatctacgcgctgctgaagcatcccgacgtgttgcagaaggcgtatgacgag
gtcgaccgcgtgctcggctccgacaccgccgtccggccgagctatcagcaggtcaaccag
ctcagctacatcacgcagattctgaaagagacgctgcgaatgtggccgccggcgccggcc
tacggcgtcgcgccgatcaaggacgaagtgatcggcggcaaatatcatctgaagcgcggc
accttcgtcaccgtgctggtgctggcgctgcatcgcgacccggcgatctgggggccgaac
ccggacgcgttcgatccggagaatttttcgcgggaagccgaatcgaagcggcccgccaat
gcctggaagccgttcggcaacggccagcgcgcctgcatcggccggggcttcgcgatgcac
gaggcggcgctggcgctcggcatgatcctgcagcgcttccagctgatcgatcaccagcgc
tatcgcatggtgctgaaggagacgctgacgatcaagcccgagggcttcaagatcaaggtg
cgtccgcgcagcgacaaggaccgcggcgatttcgtcgcggccggcgcatcgcaagtttcg
acgccggctctggcccaggccgcgccgcgcgcgcgtccggaccacaacacgccgctgctg
gtgctgtacggctccaacctcggcaccgccgaggagctggcgacccgcgtcgccgatctc
gccgaactcaacggcttttcgacgcggctcggtgcgctcgatcaatatgtcgggcacttg
ccggaagagggcggcgtgctgatcttcaccgcctcctacaacggcgcgccgccggacaat
gcgacccagttcgtgcaatggctgtctggcgatctgccgaaggatgcgttcgccaagctg
cgctacgccgtgttcggctgtggcaatcgcgactggaccgcgacctatcaggcgatcccg
cggctggtcgacgagcggctcgccgcgcatggcggccgcaacatcttcctgcgcggcgag
ggcgacgcccgcgacgatctcgaaggccagttcgaatcctggttcgccaaactcggcccg
ctggcggtgaaggagttcgggatcgacgccaaattcgctcgcgcggtcgatgatgcgccg
ctgtaccggatcgagccggtggcgcccgcagcggggaacgcggtcgccgcagcggggggc
gcggtgccgatgaaggtgctcgccaatcgcgagctgcaggattgcgccgcctcggggcgc
tcgacccgccatatcgagatcgcgctgccggaagggatcagctatcgcgtcggcgaccac
ctcagcgtgatgccgcgcaacgatccggcgctggtcgccgccgtcgcgcagcggctcggc
tttgcgccggatgatcagatcaagctgcaggtcgcgcccggccgccgcgcgcaattgccg
atcggcgaagcgatttcggtcggccgcctgctcggcgacttcgtcgaactgcagcaggtc
gcgacccgcaagcagatcgcagtcatggccgagcacacgcgctgtccgcagacccggccg
aagctgcaagcgctcgccggcggcgatggcgctgccgacgaggcctatcgcgccggcgtt
ctggcgaagcgcaagtcggtctatgatctgatgcaggagcatcccgcctgcgagttgccg
ctgcacgcttatctggaaatgctgtcgccgctggcgccgcgctactactcgatctcgtcg
tcgccgttgcgcgatccgtcgcgcgccgcgatcaccgtcgccgtggtcgatggcccggca
ttgtccggccgtggtcattatcgcggcgtctgctcgacctggctcgccggccgaagcgtc
ggcgacaccatccacgccacggtgcgcgcgaccaaagcaggtttccgcctgcccgacgac
gaccgcgtgccgctgatcatgatcgggccgggcaccgggctcgcgccgttccgcggcttc
ctgcaggagcgcgccgcgcgccagcagaacggcgcgacgctcggtccggcgctgctgttc
ttcggctgccgacatccggcgcaggactatctctatgccgacgagctgcagggcttcgct
gccgagggcgtcgtcgagctgcataccgcgttctcgcgcggcgaggggcccaagacctat
gtgcagcatctgattgccgcgcagaaggatcgggtgttcacgttgatcgagcagggcgcg
atcatctatgtctgtggcgacggcggcaaaatggagcccgacgtcagggcggcgctgatg
gcgatccatcgcgagcgcagcggcgccgatgctgcggcggcgtcgacatggatcgacgat
ctcggcgcatgcaatcgctatgtgctcgacgtctgggcgagcgcgtaa

DBGET integrated database retrieval system