KEGG   Rhodopseudomonas palustris BisB5: RPD_1858Help
Entry
RPD_1858          CDS       T00345                                 

Definition
(GenBank) putative acetyl-CoA acetyltransferase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rpd  Rhodopseudomonas palustris BisB5
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:rpd00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    RPD_1858
   00630 Glyoxylate and dicarboxylate metabolism
    RPD_1858
   00640 Propanoate metabolism
    RPD_1858
   00650 Butanoate metabolism
    RPD_1858
  Lipid metabolism
   00071 Fatty acid degradation
    RPD_1858
   00072 Synthesis and degradation of ketone bodies
    RPD_1858
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RPD_1858
   00310 Lysine degradation
    RPD_1858
   00380 Tryptophan metabolism
    RPD_1858
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    RPD_1858
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RPD_1858
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    RPD_1858
Enzymes [BR:rpd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     RPD_1858
Exosome [BR:rpd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RPD_1858
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(2078123..2079634)
Genome map
AA seq 503 aa AA seqDB search
MTTQLSPDRIPVIAGIGEIADHPKDLAQGLEPLALLEQAVRRAGADASPTFIEEIDSLDV
VNFLSWRYRDPEKLLAARLGVTPRHCQYGPVGGESPIRFIHEAALRIARGEVSVAIVCGA
EAQSTATKAARAKLELPWTPFATDVPEPKRGAAFQKPIAGQLGVARPITVYPLYEAATAA
HWGQTPRQALAESGVLWSRYAESASSNPNAWSKRAFEPGEITTPSPDNRLIAWPYTKLMV
ANPSVNLGAAVLLTSLAKAREAGIAEDRLIYIHGGASAEEPRDFLSRDQFHQSHAQNAVL
ETIKTMVGGDGRAFDAIELYSCFPVVPKMARRTLGLGDDVQPTVTGGLTFFGAPLNTYMT
HAACAMVRKLRDGAKLGLLYGQGGFVTKHHALVVSRTPPQGALSDDVSVQAKADAAYGPV
PPFITEASGNGSVETFTVIYSGRGEIEHGVVVLRTTDGARALARVPAQDQATLAFLTDMD
RSPVGTHGTISTAADGVLEWRAA
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgacaacccagctttcgcctgatcgcattcccgtcatcgccggaatcggcgagatcgcc
gatcaccccaaggaccttgcgcaaggattggagccgcttgcgttgctggagcaggccgtg
cgccgcgccggagccgatgccagccccaccttcatcgaagagatcgactcgctcgacgtc
gtcaatttcctgagctggcgctatcgcgaccccgagaagctgctggccgcgcggctcggc
gtcacgccgcgccattgccaatacggcccagtcggcggcgagagcccgatccgcttcatc
cacgaggcggcgctgcggatcgcgcgcggcgaagtcagcgtcgccattgtctgcggcgcc
gaggcgcaatcgaccgcgaccaaggcggcgcgcgccaagctcgaactgccatggacgcca
ttcgcgaccgacgtccccgagccgaagcgcggcgcggcattccagaagccgatcgcaggt
cagctcggcgttgcgcgtccgatcacggtgtatccgctctacgaggcggcaaccgcggcg
cattggggccagacgccgcgccaggcgctcgccgagtccggcgtgctatggtcgcgttac
gcggagagtgcctcgagcaatccgaacgcatggagcaagcgcgcattcgaacctggggag
atcacgaccccctcgcccgacaaccggctgatcgcctggccctacaccaagttgatggtc
gccaatcccagcgtcaatctcggcgccgcggtgctgctcacgtcgcttgcgaaggcgcgc
gaggccggcatcgccgaggacaggctgatctacatccacggcggcgcttcggcggaagag
ccacgcgatttcctgagccgcgatcagtttcaccagagccacgcgcagaacgcggtgctg
gagacgatcaagacgatggtcggcggcgacggccgcgccttcgacgcgatcgagctgtat
tcatgcttcccggtggtgccgaaaatggcgcggcggacgctcggcctcggcgacgacgta
cagccgaccgtgaccggcggactgaccttcttcggcgcgccgctcaacacctacatgacg
catgccgcctgcgcgatggtgcgcaagctccgcgacggcgccaagctcggcctgctctac
ggacaaggcggcttcgtcaccaagcatcacgcgctggtggtgtcacgaacgccgccgcag
ggcgcgctgagcgacgatgtcagcgtgcaggcgaaagcggatgctgcttacggtccggtg
ccgccgttcatcactgaagcgtccgggaacggctcggtggagaccttcaccgtgatctac
agcggtcgcggcgaaatcgagcatggcgtagttgttcttcgcaccacggacggcgcgcgg
gcgctggcgcgggtgccggcgcaggatcaggcaacgctggcgtttctgactgacatggac
cgcagcccggtcggcacgcacgggacgatctcgaccgcggctgacggcgtactggaatgg
cgcgcggcgtag

DBGET integrated database retrieval system