KEGG   Rhodopseudomonas palustris BisB5: RPD_1908Help
Entry
RPD_1908          CDS       T00345                                 

Definition
(GenBank) short chain enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
rpd  Rhodopseudomonas palustris BisB5
Pathway
rpd00071  Fatty acid degradation
rpd00280  Valine, leucine and isoleucine degradation
rpd00281  Geraniol degradation
rpd00310  Lysine degradation
rpd00360  Phenylalanine metabolism
rpd00362  Benzoate degradation
rpd00380  Tryptophan metabolism
rpd00410  beta-Alanine metabolism
rpd00627  Aminobenzoate degradation
rpd00640  Propanoate metabolism
rpd00650  Butanoate metabolism
rpd00903  Limonene and pinene degradation
rpd00930  Caprolactam degradation
rpd01100  Metabolic pathways
rpd01110  Biosynthesis of secondary metabolites
rpd01120  Microbial metabolism in diverse environments
rpd01130  Biosynthesis of antibiotics
rpd01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:rpd00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    RPD_1908
   00650 Butanoate metabolism
    RPD_1908
  Lipid metabolism
   00071 Fatty acid degradation
    RPD_1908
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RPD_1908
   00310 Lysine degradation
    RPD_1908
   00360 Phenylalanine metabolism
    RPD_1908
   00380 Tryptophan metabolism
    RPD_1908
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    RPD_1908
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    RPD_1908
   00281 Geraniol degradation
    RPD_1908
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RPD_1908
   00627 Aminobenzoate degradation
    RPD_1908
   00930 Caprolactam degradation
    RPD_1908
Enzymes [BR:rpd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     RPD_1908
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: ABE39143
JGI: RPD1908
UniProt: Q139U6
Position
complement(2145972..2146751)
Genome map
AA seq 259 aa AA seqDB search
MSNFEFIIVERQNAVGIIKLNRPKMLNALSFGVFGEIGAAVEDLEADDAIGCILITGSEK
AFAAGADIKEMQPKGFIDMFNEDFTSIGGDRLARCRKPTIAAVAGYALGGGCELAMMCDI
IIAADNAKFGQPEITLGTIPGIGGTQRLTRAIGKSKAMDLCLTGRMMDAQEAERAGLVSR
LVPADKLMEEALAAAEKIASMSRPTAAMAKSAVNRALETTLAEGLAIERDLFRSTFALED
RSEGMAAFIEKRKPNNKNR
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgagcaattttgaattcatcatcgtcgagcgccagaacgcagtcggcatcatcaagctt
aaccgtccgaagatgctcaacgcgctgtcgttcggcgtgttcggcgagatcggcgcggcg
gtcgaggacctcgaagccgacgatgcgatcggatgcatcctgatcaccggcagcgagaag
gcgttcgccgccggcgccgacatcaaggagatgcagccgaaaggcttcattgacatgttc
aacgaggacttcacctcgatcggcggcgaccgtttggcccgttgccgcaagccgaccatc
gccgcggtcgcaggttacgcgctcggcggcggctgcgaactcgcgatgatgtgcgacatc
atcattgcggccgacaacgcgaagttcggccagcctgaaatcaccctgggaacgattccg
ggtatcggaggtactcagcgactcacccgtgcgatcggcaagtcgaaggcgatggatctt
tgcctcaccggtcgaatgatggacgcgcaggaagccgaacgcgccggcctcgtcagccgt
ctcgtgccggccgacaagctgatggaagaggcgctcgccgccgccgagaaaatcgcatcg
atgtcgcgccccacagctgcgatggcgaaaagcgccgtgaaccgtgcgctggaaaccacg
ctggccgagggcctcgcgatcgaacgcgatctcttccgctcgaccttcgcactggaagat
cgctccgaaggcatggccgcgttcatcgaaaagcgcaaaccgaacaacaagaaccgctga

DBGET integrated database retrieval system