KEGG   Rhodopseudomonas palustris BisB5: RPD_1930Help
Entry
RPD_1930          CDS       T00345                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
rpd  Rhodopseudomonas palustris BisB5
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:rpd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    RPD_1930
Enzymes [BR:rpd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     RPD_1930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2168401..2168892)
Genome map
AA seq 163 aa AA seqDB search
MAEALIALGGNVGDVRATFEKAIANICGMTQGELLARSSDYATPPWGDEQQDRFVNACIA
IDTALDPMALLYTLHKIEKRFGRDRAHERRWGPRTLDLDLLAYGDAAIERPDLTLPHPRL
FERAFVLAPLVEIRPDGMIAGKSLKLALAALSTDGIERLPPRG
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atggctgaggcgctgatcgcactcggcggcaatgtcggtgatgttcgcgcgaccttcgaa
aaggcgattgccaacatctgcggcatgacccagggcgagttgctggcgcgctcctcggac
tatgcgaccccgccctggggcgacgagcaacaggaccgcttcgtcaacgcctgcatcgcg
atcgacaccgcgctcgatccgatggcgctgctgtacaccctgcacaagatcgagaagcgg
ttcggccgcgaccgcgcccacgagcggcgttgggggccgcgcacgctcgatctcgacctg
ctcgcctatggcgacgctgcgatcgagcgccccgacctgacgctgccgcatccacggctg
ttcgagcgcgccttcgtgctggcgccgctggtcgaaattcggccggatggaatgatcgcc
ggaaaatcgttgaaactggctctggcggcgctttccaccgacggaatcgagcgtctgccg
ccgcgcggctga

DBGET integrated database retrieval system