KEGG   Rhodopseudomonas palustris BisB5: RPD_2462Help
Entry
RPD_2462          CDS       T00345                                 

Definition
GGDEF domain-containing protein
Orthology
K13590  
diguanylate cyclase
Organism
rpd  Rhodopseudomonas palustris BisB5
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2749236..2750303)
Genome map
AA seq 355 aa AA seqDB search
MGSIQEEHERTMAFAEVALNQIRALRQGAMPRNYEIWYVYATGYNADLNKAINQALAAHG
TLTDADLEQLHDCYLSHGRTHERIDRIGARVVSEIDDMMSLLADALGTTASFGDNLKGAS
QKLSLTTDREQVTAIVERLVASTREMQDANAALEQRLSTSKQEITNLQANLEEIRAESLT
DPLTGLGNRKHFDRVVTEAVRSAAATRLPLSLLMMDIDHFKSFNDNYGHLTGDQVLRLVG
MTLKQTIKNKDIPSRYGGEEFAVVLPNTPLRQALVIADDIRRTVMSKELKKKSTGEILGR
VTLSAGVSTLKPEDDADALIERADACLYSAKRNGRNRVICETDPEYRSVEPAKVA
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
gtgggttctattcaagaagaacacgagcgcaccatggcgtttgccgaggttgcgctgaac
cagattcgtgcgttgcggcaaggtgcgatgccgcgcaattacgagatctggtacgtttac
gccaccggctataatgccgacctcaacaaggcgatcaaccaggcgctggcggctcacggc
accctgacggacgccgacctcgagcagttgcacgactgctatctctcccacggccgcact
cacgaacgcatcgaccggatcggcgcgcgcgtcgtcagcgagatcgacgacatgatgtcg
ctgctcgccgatgcgctcgggaccaccgcaagcttcggcgacaatctgaagggcgccagc
cagaagctgtcgctcaccaccgaccgcgaacaggtcaccgcgatcgtcgagcggctggtc
gcgtcgacccgcgagatgcaggatgccaacgccgcgctcgaacagcggctgtcgacctcc
aagcaggaaatcaccaatctgcaggccaatctcgaagagatccgcgccgagagcctgacc
gatccgctgaccggtctcggcaaccgcaagcatttcgaccgcgtcgttaccgaagcggtg
cgcagcgccgccgcgacccggctgccgctgtcgctgctgatgatggacatcgatcacttc
aagtcgttcaacgacaattacggccacctcaccggcgatcaggtgctgcggctggtcggg
atgaccctgaagcagaccatcaagaacaaggacattccctcgcgctacggcggcgaggaa
ttcgccgtggtgctgccgaacacgccgctgcgacaggcgctggtgatcgccgacgatatc
cgccgcacggtgatgtcgaaggagctgaagaagaagtcgaccggcgagatcctcggccgg
gtgacgctgtcggccggcgtgtcgacgctgaagcccgaagacgacgccgacgcgctgatc
gaacgcgccgacgcctgcctgtattccgccaagcgcaacggccgcaaccgggtgatctgc
gaaaccgaccccgaatatcgcagcgtggagccggccaaggtcgcgtaa

DBGET integrated database retrieval system